Recombinant Human ITIH3 protein, GST-tagged
| Cat.No. : | ITIH3-3624H |
| Product Overview : | Recombinant Human ITIH3 protein(601-782 aa), fused to GST tag, was expressed in E. coli. |
| Availability | January 14, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 601-782 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | MVVTKPEDNEDERAIADKPGEDAEATPVSPAMSYLTSYQPPQNPYYYVDGDPHFIIQIPEKDDALCFNIDEAPGTVLRLIQDAVTGLTVNGQITGDKRGSPDSKTRKTYFGKLGIANAQMDFQVEVTTEKITLWNRAVPSTFSWLDTVTVTQDGLSMMINRKNMVVSFGDGVTFVVVLHQVW |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | ITIH3 inter-alpha-trypsin inhibitor heavy chain 3 [ Homo sapiens ] |
| Official Symbol | ITIH3 |
| Synonyms | H3P |
| Gene ID | 3699 |
| mRNA Refseq | NM_002217.3 |
| Protein Refseq | NP_002208.3 |
| MIM | 146650 |
| UniProt ID | Q06033 |
| ◆ Recombinant Proteins | ||
| ITIH3-3129H | Recombinant Human ITIH3 Protein (Pro279-Val467), N-His tagged | +Inquiry |
| ITIH3-1568H | Recombinant Human ITIH3 protein, His & T7-tagged | +Inquiry |
| ITIH3-2643H | Recombinant Human ITIH3 Protein, MYC/DDK-tagged | +Inquiry |
| ITIH3-774H | Recombinant Human ITIH3 protein(Met1-Asp651), His-tagged | +Inquiry |
| ITIH3-3119R | Recombinant Rat ITIH3 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITIH3 Products
Required fields are marked with *
My Review for All ITIH3 Products
Required fields are marked with *
