Recombinant Human ITK protein, GST-tagged
Cat.No. : | ITK-109H |
Product Overview : | Recombinant Human ITK protein(151-258 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 151-258 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | NASKKPLPPTPEDNRRPLWEPEETVVIALYDYQTNDPQELALRRNEEYCLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSPNNLETYEWYNKSISRDKAEKLLLDTGK |
Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | ITK IL2-inducible T-cell kinase [ Homo sapiens ] |
Official Symbol | ITK |
Synonyms | ITK; IL2-inducible T-cell kinase; tyrosine-protein kinase ITK/TSK; EMT; LYK; PSCTK2; kinase EMT; T-cell-specific kinase; tyrosine-protein kinase LYK; IL-2-inducible T cell kinase; IL-2-inducible T-cell kinase; homolog of mouse T-cell itk/tsk; interleukin-2-inducible T cell kinase; interleukin-2-inducible T-cell kinase; MGC126257; MGC126258; |
Gene ID | 3702 |
mRNA Refseq | NM_005546 |
Protein Refseq | NP_005537 |
MIM | 186973 |
UniProt ID | Q08881 |
◆ Recombinant Proteins | ||
ITK-3745H | Recombinant Human ITK protein, His-tagged | +Inquiry |
ITK36899H | Recombinant Human ITK (357-620) Protein | +Inquiry |
ITK-1241HF | Active Recombinant Full Length Human ITK Protein, DDK-tagged, Biotinylated | +Inquiry |
ITK-2318R | Recombinant Rhesus monkey ITK Protein, His-tagged | +Inquiry |
ITK-2139R | Recombinant Rhesus Macaque ITK Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITK-418MCL | Recombinant Mouse ITK cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITK Products
Required fields are marked with *
My Review for All ITK Products
Required fields are marked with *
0
Inquiry Basket