Recombinant Human ITM2B, His-tagged
Cat.No. : | ITM2B-120H |
Product Overview : | Recombinant Human Integral Membrane Protein 2B/ITM2B is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Tyr76-Ser266) of Human ITM2B fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 76-266 a.a. |
Description : | Integral Membrane Protein 2B (ITM2B) is expressed in the Golgi and on the cell surface. ITM2B forms homodimer through disulfide-linked interaction with SPPL2A, SPPL2B and APP. ITM2B is expressed in brain and the other tissues. Defects in ITM2B cause cerebral amyloid angiopathy ITM2B-related type 1(CAA-ITM2B1) and amyloid angiopathy ITM2B-related type 2(CAA-ITM2B2). CAA-ITM2B1 is characterized by amyloid deposition in the walls of cerebral blood vessels and neurodegeneration in the central nervous system. CAA-ITM2B2 characterized by amyloid deposition in the walls of the blood vessels of the cerebrum, choroid plexus, cerebellum, spinal cord and retina. |
AA Sequence : | YKYFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADS DPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVI TDRIENIDHLGFFIYRLCHDKETYKLQRRETIKGIQKREASNCFAIRHFENKFAVETLICSVDHH HHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Gene Name | ITM2B integral membrane protein 2B [ Homo sapiens ] |
Official Symbol | ITM2B |
Synonyms | ITM2B; integral membrane protein 2B; BRI; E3 16; E25B; ABri/ADan amyloid peptide; transmembrane protein BRI; BRICHOS domain containing 2B; FBD; ABRI; BRI2; E3-16; BRICD2B; |
Gene ID | 9445 |
mRNA Refseq | NM_021999 |
Protein Refseq | NP_068839 |
MIM | 603904 |
UniProt ID | Q9Y287 |
Chromosome Location | 13q14.2 |
Pathway | Amyloids, organism-specific biosystem; Disease, organism-specific biosystem; IL-2 Signaling Pathway, organism-specific biosystem; |
Function | ATP binding; beta-amyloid binding; |
◆ Recombinant Proteins | ||
ITM2B-632C | Recombinant Cynomolgus ITM2B Protein, His-tagged | +Inquiry |
ITM2B-3609H | Recombinant Human ITM2B Protein (Tyr76-Ser266), C-His tagged | +Inquiry |
ITM2B-2776R | Recombinant Rat ITM2B Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL1749GF | Recombinant Full Length Chicken Integral Membrane Protein 2B(Itm2B) Protein, His-Tagged | +Inquiry |
ITM2B-2141R | Recombinant Rhesus Macaque ITM2B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITM2B-5117HCL | Recombinant Human ITM2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ITM2B Products
Required fields are marked with *
My Review for All ITM2B Products
Required fields are marked with *
0
Inquiry Basket