Recombinant Human ITM2B, His-tagged

Cat.No. : ITM2B-120H
Product Overview : Recombinant Human Integral Membrane Protein 2B/ITM2B is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Tyr76-Ser266) of Human ITM2B fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 76-266 a.a.
Description : Integral Membrane Protein 2B (ITM2B) is expressed in the Golgi and on the cell surface. ITM2B forms homodimer through disulfide-linked interaction with SPPL2A, SPPL2B and APP. ITM2B is expressed in brain and the other tissues. Defects in ITM2B cause cerebral amyloid angiopathy ITM2B-related type 1(CAA-ITM2B1) and amyloid angiopathy ITM2B-related type 2(CAA-ITM2B2). CAA-ITM2B1 is characterized by amyloid deposition in the walls of cerebral blood vessels and neurodegeneration in the central nervous system. CAA-ITM2B2 characterized by amyloid deposition in the walls of the blood vessels of the cerebrum, choroid plexus, cerebellum, spinal cord and retina.
AA Sequence : YKYFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADS DPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVI TDRIENIDHLGFFIYRLCHDKETYKLQRRETIKGIQKREASNCFAIRHFENKFAVETLICSVDHH HHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Gene Name ITM2B integral membrane protein 2B [ Homo sapiens ]
Official Symbol ITM2B
Synonyms ITM2B; integral membrane protein 2B; BRI; E3 16; E25B; ABri/ADan amyloid peptide; transmembrane protein BRI; BRICHOS domain containing 2B; FBD; ABRI; BRI2; E3-16; BRICD2B;
Gene ID 9445
mRNA Refseq NM_021999
Protein Refseq NP_068839
MIM 603904
UniProt ID Q9Y287
Chromosome Location 13q14.2
Pathway Amyloids, organism-specific biosystem; Disease, organism-specific biosystem; IL-2 Signaling Pathway, organism-specific biosystem;
Function ATP binding; beta-amyloid binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ITM2B Products

Required fields are marked with *

My Review for All ITM2B Products

Required fields are marked with *

0
cart-icon
0
compare icon