Recombinant Human ITSN1, His-tagged
Cat.No. : | ITSN1-28347TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 876-1232 of Human Intersectin 1 with N terminal His tag; Predicted MWt 40 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 876-1232 a.a. |
Description : | The protein encoded by this gene is a cytoplasmic membrane-associated protein that indirectly coordinates endocytic membrane traffic with the actin assembly machinery. In addition, the encoded protein may regulate the formation of clathrin-coated vesicles and could be involved in synaptic vesicle recycling. This protein has been shown to interact with dynamin, CDC42, SNAP23, SNAP25, SPIN90, EPS15, EPN1, EPN2, and STN2. Multiple transcript variants encoding different isoforms have been found for this gene, but the full-length nature of only two of them have been characterized so far. |
Conjugation : | HIS |
Tissue specificity : | Isoform 2 is ubiquitous in adult and fetal tissues with high expression in skeletal muscle, heart, spleen, ovary, testis and all fetal tissues tested and low expression in thymus, blood, lung, liver and pancreas. Isoform 1 is expressed almost exclusively |
Form : | Lyophilised:Reconstitute with 148 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QPSLTVPSAGQLRQRSAFTPATATGSSPSPVLGQGEKVEG LQAQALYPWRAKKDNHLNFNKNDVITVLEQQDMWWFGE VQGQKGWFPKSYVKLISGPIRKSTSMDSGSSESPASLK RVASPAAKPVVSGEEFIAMYTYESSEQGDLTFQQGDVI LVTKKDGDWWTGTVGDKAGVFPSNYVRLKDSEGSGTAGKT GSLGKKPEIAQVIASYTATGPEQLTLAPGQLILIRKKN PGGWWEGELQARGKKRQIGWFPANYVKLLSPGTSKITP TEPPKSTALAAVCQVIGMYDYTAQNDDELAFNKGQIIN VLNKEDPDWWKGEVNGQVGLFPSNYVKLTTDMDPSQQW CSDLHLLDMLT |
Sequence Similarities : | Contains 1 C2 domain.Contains 1 DH (DBL-homology) domain.Contains 2 EF-hand domains.Contains 2 EH domains.Contains 1 PH domain.Contains 5 SH3 domains. |
Gene Name | ITSN1 intersectin 1 (SH3 domain protein) [ Homo sapiens ] |
Official Symbol | ITSN1 |
Synonyms | ITSN1; intersectin 1 (SH3 domain protein); ITSN, SH3D1A; intersectin-1; human intersectin SH3 domain containing protein SH3P17; intersectin 1 short form variant 3; intersectin 1 short form variant; 11; intersectin short variant 12; MGC134948; MGC134949; S |
Gene ID | 6453 |
mRNA Refseq | NM_001001132 |
Protein Refseq | NP_001001132 |
MIM | 602442 |
Uniprot ID | Q15811 |
Chromosome Location | 21q22.1-q22.2 |
Pathway | Cell death signalling via NRAGE, NRIF and NADE, organism-specific biosystem; EPHB forward signaling, organism-specific biosystem; G alpha (12/13) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; Internalization of ErbB1, organism-specific biosystem; |
Function | Rho guanyl-nucleotide exchange factor activity; calcium ion binding; guanyl-nucleotide exchange factor activity; kinase activator activity; proline-rich region binding; |
◆ Recombinant Proteins | ||
ITSN1-16H | Recombinant Human ITSN1, GST-tagged | +Inquiry |
ITSN1-13H | Recombinant Human ITSN1 Protein, N-6×His-ABP tagged | +Inquiry |
ITSN1-8395M | Recombinant Mouse ITSN1 Protein | +Inquiry |
ITSN1-11H | Recombinant Human ITSN1 protein, His-tagged | +Inquiry |
Itsn1-1702M | Recombinant Mouse Itsn1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITSN1-09H | Recombinant Human ITSN1 Over-expression Lysate, C-Flag tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITSN1 Products
Required fields are marked with *
My Review for All ITSN1 Products
Required fields are marked with *