Recombinant Human ITSN2 Protein, GST-tagged

Cat.No. : ITSN2-4943H
Product Overview : Human ITSN2 partial ORF ( NP_006268, 471 a.a. - 571 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a cytoplasmic protein which contains SH3 domains. This protein is a member of a family of proteins involved in clathrin-mediated endocytosis. Intersectin 2 is thought to regulate the formation of clathrin-coated vesicles and also may function in the induction of T cell antigen receptor (TCR) endocytosis. Alternatively spliced transcript variants have been found for this gene that encode three distinct isoforms. Additional variants have been found but their full length nature has not been determined. [provided by RefSeq
Molecular Mass : 36.85 kDa
AA Sequence : NQKNREQEEIVRLNSKKKNLHLELEALNGKHQQISGRLQDVRLKKQTQKTELEVLDKQCDLEIMEIKQLQQELQEYQNKLIYLVPEKQLLNERIKNMQFSN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ITSN2 intersectin 2 [ Homo sapiens (human) ]
Official Symbol ITSN2
Synonyms ITSN2; intersectin 2; SWA; SWAP; SH3D1B; SH3P18; PRO2015; intersectin-2; SH3 domain-containing protein 1B; SH3P18-like WASP-associated protein
Gene ID 50618
mRNA Refseq NM_001348181
Protein Refseq NP_001335110
MIM 604464
UniProt ID Q9NZM3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ITSN2 Products

Required fields are marked with *

My Review for All ITSN2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon