Recombinant Human ITSN2 Protein, GST-tagged
Cat.No. : | ITSN2-4943H |
Product Overview : | Human ITSN2 partial ORF ( NP_006268, 471 a.a. - 571 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a cytoplasmic protein which contains SH3 domains. This protein is a member of a family of proteins involved in clathrin-mediated endocytosis. Intersectin 2 is thought to regulate the formation of clathrin-coated vesicles and also may function in the induction of T cell antigen receptor (TCR) endocytosis. Alternatively spliced transcript variants have been found for this gene that encode three distinct isoforms. Additional variants have been found but their full length nature has not been determined. [provided by RefSeq |
Molecular Mass : | 36.85 kDa |
AA Sequence : | NQKNREQEEIVRLNSKKKNLHLELEALNGKHQQISGRLQDVRLKKQTQKTELEVLDKQCDLEIMEIKQLQQELQEYQNKLIYLVPEKQLLNERIKNMQFSN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ITSN2 intersectin 2 [ Homo sapiens (human) ] |
Official Symbol | ITSN2 |
Synonyms | ITSN2; intersectin 2; SWA; SWAP; SH3D1B; SH3P18; PRO2015; intersectin-2; SH3 domain-containing protein 1B; SH3P18-like WASP-associated protein |
Gene ID | 50618 |
mRNA Refseq | NM_001348181 |
Protein Refseq | NP_001335110 |
MIM | 604464 |
UniProt ID | Q9NZM3 |
◆ Recombinant Proteins | ||
ITSN2-1703H | Recombinant Human ITSN2 Protein, His&GST-tagged | +Inquiry |
Itsn2-1704M | Recombinant Mouse Itsn2 Protein, His&GST-tagged | +Inquiry |
ITSN2-4943H | Recombinant Human ITSN2 Protein, GST-tagged | +Inquiry |
ITSN2-193H | Recombinant Human ITSN2, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITSN2 Products
Required fields are marked with *
My Review for All ITSN2 Products
Required fields are marked with *