Recombinant Human JARID2

• Cat.No.: JARID2-27632TH
• Product Overview: Recombinant fragment corresponding to amino acids 1130-1229 of Human Jarid2 with a proprietary tag at N-terminal predicted MWt 37 kDa

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: This gene is an ortholog of the mouse jumonji gene, which encodes a nuclear protein essential for mouse embryogenesis, including neural tube formation. Overexpression of mouse jumonji negatively regulates cell proliferation. The jumonji proteins contain a DNA-binding domain, called an AT-rich interaction domain (ARID), and share regions of similarity with human retinoblastoma-binding protein-2 and the human SMCX protein.
• Molecular Weight: 37.000kDa
• Tissue specificity: During embryogenesis, predominantly expressed in neurons and particularly in dorsal root ganglion cells.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: LQLETSERRCQICQHLCYLSMVVQENENVVFCLECALRHVEKQKSCRGLKLMYRYDEEQIISLVNQICGKVSGKNGSIENCLSKPTPKRGPRKRATVDVP
• Sequence Similarities: Contains 1 ARID domain.Contains 1 JmjC domain.Contains 1 JmjN domain.

Gene Information

• Gene Name: JARID2 jumonji, AT rich interactive domain 2 [ Homo sapiens ]
• Official Symbol: JARID2
• Synonyms: JARID2; jumonji, AT rich interactive domain 2; JMJ, jumonji (mouse) homolog , Jumonji, AT rich interactive domain 2; protein Jumonji
• Gene ID: 3720
• mRNA Refseq: NM_004973
• Protein Refseq: NP_004964
• MIM: 601594
• Uniprot ID: Q92833
• Chromosome Location: 6p24-p23
• Function: DNA binding; chromatin binding; NOT histone demethylase activity