Recombinant Human JARID2

Cat.No. : JARID2-27632TH
Product Overview : Recombinant fragment corresponding to amino acids 1130-1229 of Human Jarid2 with a proprietary tag at N-terminal predicted MWt 37 kDa
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene is an ortholog of the mouse jumonji gene, which encodes a nuclear protein essential for mouse embryogenesis, including neural tube formation. Overexpression of mouse jumonji negatively regulates cell proliferation. The jumonji proteins contain a DNA-binding domain, called an AT-rich interaction domain (ARID), and share regions of similarity with human retinoblastoma-binding protein-2 and the human SMCX protein.
Molecular Weight : 37.000kDa
Tissue specificity : During embryogenesis, predominantly expressed in neurons and particularly in dorsal root ganglion cells.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : LQLETSERRCQICQHLCYLSMVVQENENVVFCLECALRHVEKQKSCRGLKLMYRYDEEQIISLVNQICGKVSGKNGSIENCLSKPTPKRGPRKRATVDVP
Sequence Similarities : Contains 1 ARID domain.Contains 1 JmjC domain.Contains 1 JmjN domain.
Gene Name JARID2 jumonji, AT rich interactive domain 2 [ Homo sapiens ]
Official Symbol JARID2
Synonyms JARID2; jumonji, AT rich interactive domain 2; JMJ, jumonji (mouse) homolog , Jumonji, AT rich interactive domain 2; protein Jumonji;
Gene ID 3720
mRNA Refseq NM_004973
Protein Refseq NP_004964
MIM 601594
Uniprot ID Q92833
Chromosome Location 6p24-p23
Function DNA binding; chromatin binding; NOT histone demethylase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All JARID2 Products

Required fields are marked with *

My Review for All JARID2 Products

Required fields are marked with *

0
cart-icon