Recombinant Human JARID2
Cat.No. : | JARID2-27632TH |
Product Overview : | Recombinant fragment corresponding to amino acids 1130-1229 of Human Jarid2 with a proprietary tag at N-terminal predicted MWt 37 kDa |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene is an ortholog of the mouse jumonji gene, which encodes a nuclear protein essential for mouse embryogenesis, including neural tube formation. Overexpression of mouse jumonji negatively regulates cell proliferation. The jumonji proteins contain a DNA-binding domain, called an AT-rich interaction domain (ARID), and share regions of similarity with human retinoblastoma-binding protein-2 and the human SMCX protein. |
Molecular Weight : | 37.000kDa |
Tissue specificity : | During embryogenesis, predominantly expressed in neurons and particularly in dorsal root ganglion cells. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LQLETSERRCQICQHLCYLSMVVQENENVVFCLECALRHVEKQKSCRGLKLMYRYDEEQIISLVNQICGKVSGKNGSIENCLSKPTPKRGPRKRATVDVP |
Sequence Similarities : | Contains 1 ARID domain.Contains 1 JmjC domain.Contains 1 JmjN domain. |
Gene Name | JARID2 jumonji, AT rich interactive domain 2 [ Homo sapiens ] |
Official Symbol | JARID2 |
Synonyms | JARID2; jumonji, AT rich interactive domain 2; JMJ, jumonji (mouse) homolog , Jumonji, AT rich interactive domain 2; protein Jumonji; |
Gene ID | 3720 |
mRNA Refseq | NM_004973 |
Protein Refseq | NP_004964 |
MIM | 601594 |
Uniprot ID | Q92833 |
Chromosome Location | 6p24-p23 |
Function | DNA binding; chromatin binding; NOT histone demethylase activity; |
◆ Recombinant Proteins | ||
JARID2-27632TH | Recombinant Human JARID2 | +Inquiry |
JARID2-2976H | Recombinant Human JARID2 protein, His-tagged | +Inquiry |
JARID2-2081C | Recombinant Chicken JARID2 | +Inquiry |
JARID2-8416M | Recombinant Mouse JARID2 Protein | +Inquiry |
JARID2-4672M | Recombinant Mouse JARID2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All JARID2 Products
Required fields are marked with *
My Review for All JARID2 Products
Required fields are marked with *
0
Inquiry Basket