Recombinant Human JARID2 protein, His-tagged
Cat.No. : | JARID2-2976H |
Product Overview : | Recombinant Human JARID2 protein(1130-1228 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1130-1228 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LQLETSERRCQICQHLCYLSMVVQENENVVFCLECALRHVEKQKSCRGLKLMYRYDEEQIISLVNQICGKVSGKNGSIENCLSKPTPKRGPRKRATVDV |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | JARID2 jumonji, AT rich interactive domain 2 [ Homo sapiens ] |
Official Symbol | JARID2 |
Synonyms | JARID2; jumonji, AT rich interactive domain 2; JMJ, jumonji (mouse) homolog , Jumonji, AT rich interactive domain 2; protein Jumonji; jumonji homolog; jumonji-like protein; jumonji/ARID domain-containing protein 2; JMJ; |
Gene ID | 3720 |
mRNA Refseq | NM_004973 |
Protein Refseq | NP_004964 |
MIM | 601594 |
UniProt ID | Q92833 |
◆ Recombinant Proteins | ||
JARID2-4672M | Recombinant Mouse JARID2 Protein, His (Fc)-Avi-tagged | +Inquiry |
JARID2-27632TH | Recombinant Human JARID2 | +Inquiry |
JARID2-2976H | Recombinant Human JARID2 protein, His-tagged | +Inquiry |
JARID2-8416M | Recombinant Mouse JARID2 Protein | +Inquiry |
JARID2-2081C | Recombinant Chicken JARID2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All JARID2 Products
Required fields are marked with *
My Review for All JARID2 Products
Required fields are marked with *
0
Inquiry Basket