Recombinant Human KATNAL2 protein, His-tagged
Cat.No. : | KATNAL2-1224H |
Product Overview : | Recombinant Human KATNAL2 protein(1-200 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-200 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | MEYESYYFVKFQKYPKIVKKSSDTAENNLPQRSRGKTRRMMNDSCQNLPKINQQRPRSKTTAGKTGDTKSLNKEHPNQEVVDNTRLENANFGLHISRIRKDSGEENAHPRRGQIIDFQGLLTDAIKGATSELALNTFDHNPDPSERLLKPLSAFIGMNSEMRELAAVVSRDIYLHNPNIKWNDIIGLDAAKQLVKEAVVY |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | KATNAL2 |
Synonyms | KATNAL2; katanin p60 subunit A-like 2; katanin p60 ATPase-containing subunit A-like 2; DKFZP667C165; MGC33211; p60 katanin-like 2; DKFZp667C165; |
Gene ID | 83473 |
mRNA Refseq | NM_031303 |
Protein Refseq | NP_112593 |
UniProt ID | Q8IYT4 |
◆ Recombinant Proteins | ||
KATNAL2-1224H | Recombinant Human KATNAL2 protein, His-tagged | +Inquiry |
KATNAL2-3022H | Recombinant Human KATNAL2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
KATNAL2-8456M | Recombinant Mouse KATNAL2 Protein | +Inquiry |
Katnal2-3646M | Recombinant Mouse Katnal2 Protein, Myc/DDK-tagged | +Inquiry |
KATNAL2-3532Z | Recombinant Zebrafish KATNAL2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
KATNAL2-5085HCL | Recombinant Human KATNAL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KATNAL2 Products
Required fields are marked with *
My Review for All KATNAL2 Products
Required fields are marked with *
0
Inquiry Basket