Recombinant Human KATNAL2 protein, His-tagged
| Cat.No. : | KATNAL2-1224H |
| Product Overview : | Recombinant Human KATNAL2 protein(1-200 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-200 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | MEYESYYFVKFQKYPKIVKKSSDTAENNLPQRSRGKTRRMMNDSCQNLPKINQQRPRSKTTAGKTGDTKSLNKEHPNQEVVDNTRLENANFGLHISRIRKDSGEENAHPRRGQIIDFQGLLTDAIKGATSELALNTFDHNPDPSERLLKPLSAFIGMNSEMRELAAVVSRDIYLHNPNIKWNDIIGLDAAKQLVKEAVVY |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | KATNAL2 |
| Synonyms | KATNAL2; katanin p60 subunit A-like 2; katanin p60 ATPase-containing subunit A-like 2; DKFZP667C165; MGC33211; p60 katanin-like 2; DKFZp667C165; |
| Gene ID | 83473 |
| mRNA Refseq | NM_031303 |
| Protein Refseq | NP_112593 |
| UniProt ID | Q8IYT4 |
| ◆ Recombinant Proteins | ||
| KATNAL2-3022H | Recombinant Human KATNAL2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| KATNAL2-4705M | Recombinant Mouse KATNAL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Katnal2-3646M | Recombinant Mouse Katnal2 Protein, Myc/DDK-tagged | +Inquiry |
| KATNAL2-8456M | Recombinant Mouse KATNAL2 Protein | +Inquiry |
| KATNAL2-223H | Recombinant Human KATNAL2 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KATNAL2-5085HCL | Recombinant Human KATNAL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KATNAL2 Products
Required fields are marked with *
My Review for All KATNAL2 Products
Required fields are marked with *
