Recombinant Human KCNA3
Cat.No. : | KCNA3-29890TH |
Product Overview : | Recombinant fragment of Human KCNA3 with a N terminal proprietary tag: predicted molecular weight 36.63 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. It plays an essential role in T-cell proliferation and activation. This gene appears to be intronless and it is clustered together with KCNA2 and KCNA10 genes on chromosome 1. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VPVIVSNFNYFYHRETEGEEQSQYMHVGSCQHLSSSAEELRKARSNSTLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV |
Sequence Similarities : | Belongs to the potassium channel family. A (Shaker) (TC 1.A.1.2) subfamily. Kv1.3/KCNA3 sub-subfamily. |
Gene Name | KCNA3 potassium voltage-gated channel, shaker-related subfamily, member 3 [ Homo sapiens ] |
Official Symbol | KCNA3 |
Synonyms | KCNA3; potassium voltage-gated channel, shaker-related subfamily, member 3; potassium voltage-gated channel subfamily A member 3; HLK3; HPCN3; Kv1.3; MK3; |
Gene ID | 3738 |
mRNA Refseq | NM_002232 |
Protein Refseq | NP_002223 |
MIM | 176263 |
Uniprot ID | P22001 |
Chromosome Location | 1p13.3 |
Pathway | Neuronal System, organism-specific biosystem; Potassium Channels, organism-specific biosystem; Voltage gated Potassium channels, organism-specific biosystem; |
Function | delayed rectifier potassium channel activity; outward rectifier potassium channel activity; voltage-gated ion channel activity; |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KCNA3 Products
Required fields are marked with *
My Review for All KCNA3 Products
Required fields are marked with *
0
Inquiry Basket