Recombinant Human KCNA3 protein, His-tagged

Cat.No. : KCNA3-316H
Product Overview : Recombinant Human KCNA3 protein(NP_002223)(1-226 aa), fused to His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-226 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MDERLSLLRSPPPPSARHRAHPPQRPASSGGAHTLVNHGYAEPAAGRELPPDMTVVPGDHLLEPEVADGGGAPPQGGCGGGGCDRYEPLPPSLPAAGEQDCCGERVVINISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEY
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles.
Concentration : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name KCNA3 potassium voltage-gated channel, shaker-related subfamily, member 3 [ Homo sapiens ]
Official Symbol KCNA3
Synonyms KCNA3; potassium voltage-gated channel, shaker-related subfamily, member 3; potassium voltage-gated channel subfamily A member 3; HLK3; HPCN3; Kv1.3; MK3; potassium channel 3; type n potassium channel; voltage-gated K(+) channel HuKIII; voltage-gated potassium channel protein Kv1.3; voltage-gated potassium channel subunit Kv1.3; HGK5; PCN3; KV1.3; HUKIII;
Gene ID 3738
mRNA Refseq NM_002232
Protein Refseq NP_002223
MIM 176263
UniProt ID P22001

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KCNA3 Products

Required fields are marked with *

My Review for All KCNA3 Products

Required fields are marked with *

0
cart-icon