Recombinant Human KCNA3 protein, His-tagged
Cat.No. : | KCNA3-316H |
Product Overview : | Recombinant Human KCNA3 protein(NP_002223)(1-226 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-226 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MDERLSLLRSPPPPSARHRAHPPQRPASSGGAHTLVNHGYAEPAAGRELPPDMTVVPGDHLLEPEVADGGGAPPQGGCGGGGCDRYEPLPPSLPAAGEQDCCGERVVINISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEY |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles. |
Concentration : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | KCNA3 potassium voltage-gated channel, shaker-related subfamily, member 3 [ Homo sapiens ] |
Official Symbol | KCNA3 |
Synonyms | KCNA3; potassium voltage-gated channel, shaker-related subfamily, member 3; potassium voltage-gated channel subfamily A member 3; HLK3; HPCN3; Kv1.3; MK3; potassium channel 3; type n potassium channel; voltage-gated K(+) channel HuKIII; voltage-gated potassium channel protein Kv1.3; voltage-gated potassium channel subunit Kv1.3; HGK5; PCN3; KV1.3; HUKIII; |
Gene ID | 3738 |
mRNA Refseq | NM_002232 |
Protein Refseq | NP_002223 |
MIM | 176263 |
UniProt ID | P22001 |
◆ Recombinant Proteins | ||
KCNA3-4716M | Recombinant Mouse KCNA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL33207RF | Recombinant Full Length Rat Potassium Voltage-Gated Channel Subfamily A Member 3(Kcna3) Protein, His-Tagged | +Inquiry |
KCNA3-29890TH | Recombinant Human KCNA3 | +Inquiry |
KCNA3-2242C | Recombinant Chicken KCNA3 | +Inquiry |
KCNA3-2822R | Recombinant Rat KCNA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KCNA3 Products
Required fields are marked with *
My Review for All KCNA3 Products
Required fields are marked with *
0
Inquiry Basket