Recombinant Human KCNJ12 protein, His-tagged
Cat.No. : | KCNJ12-3415H |
Product Overview : | Recombinant Human KCNJ12 protein(182-433 aa), fused to His tag, was expressed in E. coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 182-433 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | AKMARPKKRAQTLLFSHNAVVALRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRVTEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIDEASPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLANEILWGHRFEPVLFEEKNQYKIDYSHFHKTYEVPSTPRCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGGVLEQRPYRRESEI |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | KCNJ12 potassium inwardly-rectifying channel, subfamily J, member 12 [ Homo sapiens ] |
Official Symbol | KCNJ12 |
Synonyms | KCNJ12; potassium inwardly-rectifying channel, subfamily J, member 12; KCNJN1, potassium inwardly rectifying channel, subfamily J, inhibitor 1; ATP-sensitive inward rectifier potassium channel 12; hIRK1; IRK2; Kir2.2; Kir2.2v; inward rectifier K(+) channel Kir2.2; inward rectifier K(+) channel Kir2.6; inward rectifier K(+) channel Kir2.2v; potassium channel, inwardly rectifying subfamily J member 12; potassium inwardly-rectifying channel, subfamily J, inhibitor 1; hIRK; IRK-2; KCNJN1; kcnj12x; hkir2.2x; FLJ14167; |
Gene ID | 3768 |
mRNA Refseq | NM_021012 |
Protein Refseq | NP_066292 |
MIM | 602323 |
UniProt ID | Q14500 |
◆ Recombinant Proteins | ||
KCNJ12-252H | Recombinant Human KCNJ12, GST-tagged | +Inquiry |
Kcnj12-3757R | Recombinant Rat Kcnj12, His-tagged | +Inquiry |
KCNJ12-8512M | Recombinant Mouse KCNJ12 Protein | +Inquiry |
KCNJ12-4735M | Recombinant Mouse KCNJ12 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL13428HF | Recombinant Full Length Human Atp-Sensitive Inward Rectifier Potassium Channel 12(Kcnj12) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCNJ12 Products
Required fields are marked with *
My Review for All KCNJ12 Products
Required fields are marked with *