Recombinant Human KCNJ15

• Cat.No.: KCNJ15-28454TH
• Product Overview: Recombinant fragment of Human KCNJ15 with N-terminal proprietary tag. Predicted MW 32.89 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 66 amino acids
• Description: Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein has a greater tendency to allow potassium to flow into a cell rather than out of a cell. Three transcript variants encoding the same protein have been found for this gene.
• Molecular Weight: 32.890kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: TSAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQLEEKY
• Sequence Similarities: Belongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ15 subfamily.

Gene Information

• Gene Name: KCNJ15 potassium inwardly-rectifying channel, subfamily J, member 15 [ Homo sapiens ]
• Official Symbol: KCNJ15
• Synonyms: KCNJ15; potassium inwardly-rectifying channel, subfamily J, member 15; ATP-sensitive inward rectifier potassium channel 15; IRKK; Kir1.3; Kir4.2
• Gene ID: 3772
• mRNA Refseq: NM_002243
• Protein Refseq: NP_002234
• MIM: 602106
• Uniprot ID: Q99712
• Chromosome Location: 21q22.2
• Pathway: Activation of G protein gated Potassium channels, organism-specific biosystem; Activation of GABAB receptors, organism-specific biosystem; G protein gated Potassium channels, organism-specific biosystem; GABA B receptor activation, organism-specific biosystem; GABA receptor activation, organism-specific biosystem
• Function: inward rectifier potassium channel activity; potassium channel activity; voltage-gated ion channel activity