Recombinant Human KCNJ15
Cat.No. : | KCNJ15-28454TH |
Product Overview : | Recombinant fragment of Human KCNJ15 with N-terminal proprietary tag. Predicted MW 32.89 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 66 amino acids |
Description : | Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein has a greater tendency to allow potassium to flow into a cell rather than out of a cell. Three transcript variants encoding the same protein have been found for this gene. |
Molecular Weight : | 32.890kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | TSAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQLEEKY |
Sequence Similarities : | Belongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ15 subfamily. |
Gene Name | KCNJ15 potassium inwardly-rectifying channel, subfamily J, member 15 [ Homo sapiens ] |
Official Symbol | KCNJ15 |
Synonyms | KCNJ15; potassium inwardly-rectifying channel, subfamily J, member 15; ATP-sensitive inward rectifier potassium channel 15; IRKK; Kir1.3; Kir4.2; |
Gene ID | 3772 |
mRNA Refseq | NM_002243 |
Protein Refseq | NP_002234 |
MIM | 602106 |
Uniprot ID | Q99712 |
Chromosome Location | 21q22.2 |
Pathway | Activation of G protein gated Potassium channels, organism-specific biosystem; Activation of GABAB receptors, organism-specific biosystem; G protein gated Potassium channels, organism-specific biosystem; GABA B receptor activation, organism-specific biosystem; GABA receptor activation, organism-specific biosystem; |
Function | inward rectifier potassium channel activity; potassium channel activity; voltage-gated ion channel activity; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCNJ15 Products
Required fields are marked with *
My Review for All KCNJ15 Products
Required fields are marked with *
0
Inquiry Basket