Recombinant Human KCNJ15

Cat.No. : KCNJ15-28454TH
Product Overview : Recombinant fragment of Human KCNJ15 with N-terminal proprietary tag. Predicted MW 32.89 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 66 amino acids
Description : Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein has a greater tendency to allow potassium to flow into a cell rather than out of a cell. Three transcript variants encoding the same protein have been found for this gene.
Molecular Weight : 32.890kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : TSAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQLEEKY
Sequence Similarities : Belongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ15 subfamily.
Gene Name KCNJ15 potassium inwardly-rectifying channel, subfamily J, member 15 [ Homo sapiens ]
Official Symbol KCNJ15
Synonyms KCNJ15; potassium inwardly-rectifying channel, subfamily J, member 15; ATP-sensitive inward rectifier potassium channel 15; IRKK; Kir1.3; Kir4.2;
Gene ID 3772
mRNA Refseq NM_002243
Protein Refseq NP_002234
MIM 602106
Uniprot ID Q99712
Chromosome Location 21q22.2
Pathway Activation of G protein gated Potassium channels, organism-specific biosystem; Activation of GABAB receptors, organism-specific biosystem; G protein gated Potassium channels, organism-specific biosystem; GABA B receptor activation, organism-specific biosystem; GABA receptor activation, organism-specific biosystem;
Function inward rectifier potassium channel activity; potassium channel activity; voltage-gated ion channel activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KCNJ15 Products

Required fields are marked with *

My Review for All KCNJ15 Products

Required fields are marked with *

0
cart-icon
0
compare icon