Recombinant Human KCNJ15
| Cat.No. : | KCNJ15-28454TH |
| Product Overview : | Recombinant fragment of Human KCNJ15 with N-terminal proprietary tag. Predicted MW 32.89 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 66 amino acids |
| Description : | Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein has a greater tendency to allow potassium to flow into a cell rather than out of a cell. Three transcript variants encoding the same protein have been found for this gene. |
| Molecular Weight : | 32.890kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | TSAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQLEEKY |
| Sequence Similarities : | Belongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ15 subfamily. |
| Gene Name | KCNJ15 potassium inwardly-rectifying channel, subfamily J, member 15 [ Homo sapiens ] |
| Official Symbol | KCNJ15 |
| Synonyms | KCNJ15; potassium inwardly-rectifying channel, subfamily J, member 15; ATP-sensitive inward rectifier potassium channel 15; IRKK; Kir1.3; Kir4.2; |
| Gene ID | 3772 |
| mRNA Refseq | NM_002243 |
| Protein Refseq | NP_002234 |
| MIM | 602106 |
| Uniprot ID | Q99712 |
| Chromosome Location | 21q22.2 |
| Pathway | Activation of G protein gated Potassium channels, organism-specific biosystem; Activation of GABAB receptors, organism-specific biosystem; G protein gated Potassium channels, organism-specific biosystem; GABA B receptor activation, organism-specific biosystem; GABA receptor activation, organism-specific biosystem; |
| Function | inward rectifier potassium channel activity; potassium channel activity; voltage-gated ion channel activity; |
| ◆ Recombinant Proteins | ||
| KCNJ15-28454TH | Recombinant Human KCNJ15 | +Inquiry |
| KCNJ15-2855R | Recombinant Rat KCNJ15 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL11648RF | Recombinant Full Length Rat Atp-Sensitive Inward Rectifier Potassium Channel 15(Kcnj15) Protein, His-Tagged | +Inquiry |
| RFL28559CF | Recombinant Full Length Guinea Pig Atp-Sensitive Inward Rectifier Potassium Channel 15(Kcnj15) Protein, His-Tagged | +Inquiry |
| Kcnj15-3759M | Recombinant Mouse Kcnj15, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCNJ15 Products
Required fields are marked with *
My Review for All KCNJ15 Products
Required fields are marked with *
