Recombinant Human KCNK1
| Cat.No. : | KCNK1-28456TH |
| Product Overview : | Recombinant fragment of Human KCNK1 protein with an N terminal proprietary tag. Predicted MW 33.55 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 72 amino acids |
| Description : | This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The product of this gene has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity. |
| Molecular Weight : | 33.550kDa inclusive of tags |
| Tissue specificity : | Widely expressed with high levels in heart and brain and lower levels in placenta, lung, liver and kidney. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | ETFCELHELKKFRKMFYVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH |
| Sequence Similarities : | Belongs to the two pore domain potassium channel (TC 1.A.1.8) family. |
| Gene Name | KCNK1 potassium channel, subfamily K, member 1 [ Homo sapiens ] |
| Official Symbol | KCNK1 |
| Synonyms | KCNK1; potassium channel, subfamily K, member 1; potassium channel subfamily K member 1; DPK; K2p1.1; TWIK 1; |
| Gene ID | 3775 |
| mRNA Refseq | NM_002245 |
| Protein Refseq | NP_002236 |
| MIM | 601745 |
| Uniprot ID | O00180 |
| Chromosome Location | 1q42-q43 |
| Pathway | Neuronal System, organism-specific biosystem; Potassium Channels, organism-specific biosystem; Tandem of pore domain in a weak inwardly rectifying K+ channels (TWIK), organism-specific biosystem; Tandem pore domain potassium channels, organism-specific biosystem; |
| Function | inward rectifier potassium channel activity; ion channel activity; potassium channel activity; voltage-gated ion channel activity; |
| ◆ Recombinant Proteins | ||
| RFL19836CF | Recombinant Full Length Guinea Pig Potassium Channel Subfamily K Member 1(Kcnk1) Protein, His-Tagged | +Inquiry |
| RFL32237HF | Recombinant Full Length Human Potassium Channel Subfamily K Member 1(Kcnk1) Protein, His-Tagged | +Inquiry |
| KCNK1-8524M | Recombinant Mouse KCNK1 Protein | +Inquiry |
| KCNK1-2862R | Recombinant Rat KCNK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| KCNK1-3206R | Recombinant Rat KCNK1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KCNK1-223HCL | Recombinant Human KCNK1 Lysate | +Inquiry |
| KCNK1-5041HCL | Recombinant Human KCNK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCNK1 Products
Required fields are marked with *
My Review for All KCNK1 Products
Required fields are marked with *



