Recombinant Human KCNMB3 Protein, hFc-His-tagged
| Cat.No. : | KCNMB3-33H |
| Product Overview : | Recombinant Human KCNMB3 Protein(Q9NPA1)(Glu91-Ile200), fused with C-terminal hFc tag and His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Fc&His |
| Protein Length : | Glu91-Ile200 |
| Form : | Phosphate buffered saline |
| Storage : | Store at -20 to -80°C. |
| Molecular Mass : | 42 kDa |
| AA Sequence : | EESTCTAIHTDIMDDWLDCAFTCGVHCHGQGKYPCLQVFVNLSHPGQKALLHYNEEAVQINPKCFYTPKCHQDRNDLLNSALDIKEFFDHKNGTPFSCFYSPASQSEDVI |
| Official Symbol | KCNMB3 |
| Synonyms | KCNMB3; potassium large conductance calcium-activated channel, subfamily M beta member 3; KCNMB2, KCNMBL; calcium-activated potassium channel subunit beta-3; slo-beta-3; K(VCA)beta-3; BK channel subunit beta-3; maxi K channel subunit beta-3; charybdotoxin receptor subunit beta-3; calcium-activated potassium channel, subfamily M subunit beta-3; large conductance, voltage and Ca2+ activated potassium channel Maxi K beta 3 subunit; HBETA3; KCNMB2; KCNMBL; BKBETA3; SLOBETA3; |
| Gene ID | 27094 |
| mRNA Refseq | NM_001163677 |
| Protein Refseq | NP_001157149 |
| MIM | 605222 |
| UniProt ID | Q9NPA1 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCNMB3 Products
Required fields are marked with *
My Review for All KCNMB3 Products
Required fields are marked with *



