Recombinant Human KCNN4 protein, His-tagged

Cat.No. : KCNN4-3768H
Product Overview : Recombinant Human KCNN4 protein(304-427 aa), fused to His tag, was expressed in E. coli.
Availability August 21, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 304-427 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : DIQYTKEMKESAARVLQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRKLREQVNSMVDISKMHMILYDLQQNLSSSHRALEKQIDTLAGKLDALTELLSTALGPRQLPEPSQQSK
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name KCNN4 potassium intermediate/small conductance calcium-activated channel, subfamily N, member 4 [ Homo sapiens ]
Official Symbol KCNN4
Synonyms KCNN4; potassium intermediate/small conductance calcium-activated channel, subfamily N, member 4; intermediate conductance calcium-activated potassium channel protein 4; hIKCa1; hKCa4; hSK4; KCa3.1; SKCa4; SKCa 4; putative Gardos channel; putative erythrocyte intermediate conductance calcium-activated potassium Gardos channel; IK1; SK4; KCA4; IKCA1;
Gene ID 3783
mRNA Refseq NM_002250
Protein Refseq NP_002241
MIM 602754
UniProt ID O15554

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KCNN4 Products

Required fields are marked with *

My Review for All KCNN4 Products

Required fields are marked with *

0
cart-icon
0
compare icon