Recombinant Human KCNN4 protein, His-tagged
| Cat.No. : | KCNN4-3768H |
| Product Overview : | Recombinant Human KCNN4 protein(304-427 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 07, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 304-427 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | DIQYTKEMKESAARVLQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRKLREQVNSMVDISKMHMILYDLQQNLSSSHRALEKQIDTLAGKLDALTELLSTALGPRQLPEPSQQSK |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | KCNN4 potassium intermediate/small conductance calcium-activated channel, subfamily N, member 4 [ Homo sapiens ] |
| Official Symbol | KCNN4 |
| Synonyms | KCNN4; potassium intermediate/small conductance calcium-activated channel, subfamily N, member 4; intermediate conductance calcium-activated potassium channel protein 4; hIKCa1; hKCa4; hSK4; KCa3.1; SKCa4; SKCa 4; putative Gardos channel; putative erythrocyte intermediate conductance calcium-activated potassium Gardos channel; IK1; SK4; KCA4; IKCA1; |
| Gene ID | 3783 |
| mRNA Refseq | NM_002250 |
| Protein Refseq | NP_002241 |
| MIM | 602754 |
| UniProt ID | O15554 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCNN4 Products
Required fields are marked with *
My Review for All KCNN4 Products
Required fields are marked with *
