Recombinant Human KCNQ2 protein, GST-tagged

Cat.No. : KCNQ2-301222H
Product Overview : Recombinant Human KCNQ2 (1-81 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met1-Leu81
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MVQKSRNGGVYPGPSGEKKLKVGFVGLDPGAPDSTRDGALLIAGSEAPKRGSILSKPRAGGAGAGKPPKRNAFYRKLQNFL
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name KCNQ2 potassium voltage-gated channel, KQT-like subfamily, member 2 [ Homo sapiens ]
Official Symbol KCNQ2
Synonyms KCNQ2; potassium voltage-gated channel, KQT-like subfamily, member 2; EBN, EBN1; potassium voltage-gated channel subfamily KQT member 2; BFNC; ENB1; HNSPC; KCNA11; Kv7.2; KQT-like 2; voltage-gated potassium channel subunit Kv7.2; neuroblastoma-specific potassium channel protein; neuroblastoma-specific potassium channel subunit alpha KvLQT2; EBN; EBN1; BFNS1; EIEE7; KV7.2; KVEBN1;
Gene ID 3785
mRNA Refseq NM_004518
Protein Refseq NP_004509
MIM 602235
UniProt ID O43526

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KCNQ2 Products

Required fields are marked with *

My Review for All KCNQ2 Products

Required fields are marked with *

0
cart-icon
0
compare icon