Recombinant Human KCNQ2 protein, GST-tagged
Cat.No. : | KCNQ2-301222H |
Product Overview : | Recombinant Human KCNQ2 (1-81 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Leu81 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MVQKSRNGGVYPGPSGEKKLKVGFVGLDPGAPDSTRDGALLIAGSEAPKRGSILSKPRAGGAGAGKPPKRNAFYRKLQNFL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | KCNQ2 potassium voltage-gated channel, KQT-like subfamily, member 2 [ Homo sapiens ] |
Official Symbol | KCNQ2 |
Synonyms | KCNQ2; potassium voltage-gated channel, KQT-like subfamily, member 2; EBN, EBN1; potassium voltage-gated channel subfamily KQT member 2; BFNC; ENB1; HNSPC; KCNA11; Kv7.2; KQT-like 2; voltage-gated potassium channel subunit Kv7.2; neuroblastoma-specific potassium channel protein; neuroblastoma-specific potassium channel subunit alpha KvLQT2; EBN; EBN1; BFNS1; EIEE7; KV7.2; KVEBN1; |
Gene ID | 3785 |
mRNA Refseq | NM_004518 |
Protein Refseq | NP_004509 |
MIM | 602235 |
UniProt ID | O43526 |
◆ Recombinant Proteins | ||
KCNQ2-3222R | Recombinant Rat KCNQ2 Protein | +Inquiry |
KCNQ2-301222H | Recombinant Human KCNQ2 protein, GST-tagged | +Inquiry |
KCNQ2-2878R | Recombinant Rat KCNQ2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCNQ2-5019HCL | Recombinant Human KCNQ2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCNQ2 Products
Required fields are marked with *
My Review for All KCNQ2 Products
Required fields are marked with *