Recombinant Human KCTD5 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | KCTD5-5489H |
Product Overview : | KCTD5 MS Standard C13 and N15-labeled recombinant protein (NP_061865) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Its interaction with CUL3 suggests that it may act as a substrate adapter in some E3 ligase complex. Does not affect the function of Kv channel Kv2.1/KCNB1, Kv1.2/KCNA2, Kv4.2/KCND2 and Kv3.4/KCNC4. |
Molecular Mass : | 26.1 kDa |
AA Sequence : | MAENHCELLSPARGGIGAGLGGGLCRRCSAGLGALAQRPGSVSKWVRLNVGGTYFLTTRQTLCRDPKSFLYRLCQADPDLDSDKDETGAYLIDRDPTYFGPVLNYLRHGKLVINKDLAEEGVLEEAEFYNITSLIKLVKDKIRERDSKTSQVPVKHVYRVLQCQEEELTQMVSTMSDGWKFEQLVSIGSSYNYGNEDQAEFLCVVSKELHNTPYGTASEPSEKAKILQERGSRMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | KCTD5 potassium channel tetramerisation domain containing 5 [ Homo sapiens (human) ] |
Official Symbol | KCTD5 |
Synonyms | KCTD5; potassium channel tetramerisation domain containing 5; BTB/POZ domain-containing protein KCTD5; FLJ20040; |
Gene ID | 54442 |
mRNA Refseq | NM_018992 |
Protein Refseq | NP_061865 |
MIM | 611285 |
UniProt ID | Q9NXV2 |
◆ Recombinant Proteins | ||
KCTD5-3619H | Recombinant Human KCTD5 protein, GST-tagged | +Inquiry |
KCTD5-2887R | Recombinant Rat KCTD5 Protein, His (Fc)-Avi-tagged | +Inquiry |
KCTD5-4768M | Recombinant Mouse KCTD5 Protein, His (Fc)-Avi-tagged | +Inquiry |
KCTD5-8575M | Recombinant Mouse KCTD5 Protein | +Inquiry |
KCTD5-359H | Recombinant Human potassium channel tetramerization domain containing 5, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCTD5-5005HCL | Recombinant Human KCTD5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCTD5 Products
Required fields are marked with *
My Review for All KCTD5 Products
Required fields are marked with *