Recombinant Human KCTD5 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: KCTD5-5489H
• Product Overview: KCTD5 MS Standard C13 and N15-labeled recombinant protein (NP_061865) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Its interaction with CUL3 suggests that it may act as a substrate adapter in some E3 ligase complex. Does not affect the function of Kv channel Kv2.1/KCNB1, Kv1.2/KCNA2, Kv4.2/KCND2 and Kv3.4/KCNC4.
• Molecular Mass: 26.1 kDa
• AA Sequence: MAENHCELLSPARGGIGAGLGGGLCRRCSAGLGALAQRPGSVSKWVRLNVGGTYFLTTRQTLCRDPKSFLYRLCQADPDLDSDKDETGAYLIDRDPTYFGPVLNYLRHGKLVINKDLAEEGVLEEAEFYNITSLIKLVKDKIRERDSKTSQVPVKHVYRVLQCQEEELTQMVSTMSDGWKFEQLVSIGSSYNYGNEDQAEFLCVVSKELHNTPYGTASEPSEKAKILQERGSRMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: KCTD5 potassium channel tetramerisation domain containing 5 [ Homo sapiens (human) ]
• Official Symbol: KCTD5
• Synonyms: KCTD5; potassium channel tetramerisation domain containing 5; BTB/POZ domain-containing protein KCTD5; FLJ20040
• Gene ID: 54442
• mRNA Refseq: NM_018992
• Protein Refseq: NP_061865
• MIM: 611285
• UniProt ID: Q9NXV2