Recombinant Human KCTD5 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : KCTD5-5489H
Product Overview : KCTD5 MS Standard C13 and N15-labeled recombinant protein (NP_061865) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Its interaction with CUL3 suggests that it may act as a substrate adapter in some E3 ligase complex. Does not affect the function of Kv channel Kv2.1/KCNB1, Kv1.2/KCNA2, Kv4.2/KCND2 and Kv3.4/KCNC4.
Molecular Mass : 26.1 kDa
AA Sequence : MAENHCELLSPARGGIGAGLGGGLCRRCSAGLGALAQRPGSVSKWVRLNVGGTYFLTTRQTLCRDPKSFLYRLCQADPDLDSDKDETGAYLIDRDPTYFGPVLNYLRHGKLVINKDLAEEGVLEEAEFYNITSLIKLVKDKIRERDSKTSQVPVKHVYRVLQCQEEELTQMVSTMSDGWKFEQLVSIGSSYNYGNEDQAEFLCVVSKELHNTPYGTASEPSEKAKILQERGSRMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name KCTD5 potassium channel tetramerisation domain containing 5 [ Homo sapiens (human) ]
Official Symbol KCTD5
Synonyms KCTD5; potassium channel tetramerisation domain containing 5; BTB/POZ domain-containing protein KCTD5; FLJ20040;
Gene ID 54442
mRNA Refseq NM_018992
Protein Refseq NP_061865
MIM 611285
UniProt ID Q9NXV2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KCTD5 Products

Required fields are marked with *

My Review for All KCTD5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon