Recombinant Human KDM1B protein, GST-tagged
| Cat.No. : | KDM1B-6745H |
| Product Overview : | Recombinant Human KDM1B protein(666-822 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 666-822 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | FPYRFWDSKVQGADFFGHVPPSASKRGLFAVFYDMDPQKKHSVLMSVIAGEAVASVRTLDDKQVLQQCMATLRELFKEQEVPDPTKYFVTRWSTDPWIQMAYSFVKTGGSGEAYDIIAEDIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKIAAF |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | KDM1B lysine (K)-specific demethylase 1B [ Homo sapiens ] |
| Official Symbol | KDM1B |
| Synonyms | KDM1B; lysine (K)-specific demethylase 1B; amine oxidase (flavin containing) domain 1 , amine oxidase, flavin containing 1 , AOF1, C6orf193, chromosome 6 open reading frame 193; lysine-specific histone demethylase 1B; bA204B7.3; dJ298J15.2; FLJ33898; FLJ34109; FLJ43328; LSD2; amine oxidase, flavin containing 1; lysine-specific histone demethylase 2; amine oxidase (flavin containing) domain 1; flavin-containing amine oxidase domain-containing protein 1; AOF1; C6orf193; DKFZp686I0412; |
| Gene ID | 221656 |
| mRNA Refseq | NM_153042 |
| Protein Refseq | NP_694587 |
| MIM | 613081 |
| UniProt ID | Q8NB78 |
| ◆ Recombinant Proteins | ||
| KDM1B-4776M | Recombinant Mouse KDM1B Protein, His (Fc)-Avi-tagged | +Inquiry |
| KDM1B-6745H | Recombinant Human KDM1B protein, GST-tagged | +Inquiry |
| AOF1-642H | Recombinant Human AOF1 protein, GST-tagged | +Inquiry |
| KDM1B-6744H | Recombinant Human KDM1B protein, His-tagged | +Inquiry |
| KDM1B-8586M | Recombinant Mouse KDM1B Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KDM1B-219HKCL | Human KDM1B Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KDM1B Products
Required fields are marked with *
My Review for All KDM1B Products
Required fields are marked with *
