Recombinant Human KDM1B protein, GST-tagged

Cat.No. : KDM1B-6745H
Product Overview : Recombinant Human KDM1B protein(666-822 aa), fused with N-terminal GST tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 666-822 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
AASequence : FPYRFWDSKVQGADFFGHVPPSASKRGLFAVFYDMDPQKKHSVLMSVIAGEAVASVRTLDDKQVLQQCMATLRELFKEQEVPDPTKYFVTRWSTDPWIQMAYSFVKTGGSGEAYDIIAEDIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKIAAF
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name KDM1B lysine (K)-specific demethylase 1B [ Homo sapiens ]
Official Symbol KDM1B
Synonyms KDM1B; lysine (K)-specific demethylase 1B; amine oxidase (flavin containing) domain 1 , amine oxidase, flavin containing 1 , AOF1, C6orf193, chromosome 6 open reading frame 193; lysine-specific histone demethylase 1B; bA204B7.3; dJ298J15.2; FLJ33898; FLJ34109; FLJ43328; LSD2; amine oxidase, flavin containing 1; lysine-specific histone demethylase 2; amine oxidase (flavin containing) domain 1; flavin-containing amine oxidase domain-containing protein 1; AOF1; C6orf193; DKFZp686I0412;
Gene ID 221656
mRNA Refseq NM_153042
Protein Refseq NP_694587
MIM 613081
UniProt ID Q8NB78

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KDM1B Products

Required fields are marked with *

My Review for All KDM1B Products

Required fields are marked with *

0
cart-icon
0
compare icon