Recombinant Human KDM1B protein, His-tagged

• Cat.No.: KDM1B-6744H
• Product Overview: Recombinant Human KDM1B protein(666-822 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 666-822 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: FPYRFWDSKVQGADFFGHVPPSASKRGLFAVFYDMDPQKKHSVLMSVIAGEAVASVRTLDDKQVLQQCMATLRELFKEQEVPDPTKYFVTRWSTDPWIQMAYSFVKTGGSGEAYDIIAEDIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKIAAF
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: KDM1B lysine (K)-specific demethylase 1B [ Homo sapiens ]
• Official Symbol: KDM1B
• Synonyms: KDM1B; lysine (K)-specific demethylase 1B; amine oxidase (flavin containing) domain 1 , amine oxidase, flavin containing 1 , AOF1, C6orf193, chromosome 6 open reading frame 193; lysine-specific histone demethylase 1B; bA204B7.3; dJ298J15.2; FLJ33898; FLJ34109; FLJ43328; LSD2; amine oxidase, flavin containing 1; lysine-specific histone demethylase 2; amine oxidase (flavin containing) domain 1; flavin-containing amine oxidase domain-containing protein 1; AOF1; C6orf193; DKFZp686I0412
• Gene ID: 221656
• mRNA Refseq: NM_153042
• Protein Refseq: NP_694587
• MIM: 613081
• UniProt ID: Q8NB78