Recombinant Human KDR protein(1201-1300 aa), C-His-tagged
| Cat.No. : | KDR-2742H |
| Product Overview : | Recombinant Human KDR protein(P35968)(1201-1300 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1201-1300 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | CMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDSGMVLASEELKTLEDRTKLSPSFGGMVPSKSRESVASEGSN |
| Gene Name | KDR kinase insert domain receptor (a type III receptor tyrosine kinase) [ Homo sapiens ] |
| Official Symbol | KDR |
| Synonyms | KDR; kinase insert domain receptor (a type III receptor tyrosine kinase); vascular endothelial growth factor receptor 2; CD309; FLK1; VEGFR; VEGFR2; soluble VEGFR2; fetal liver kinase 1; fetal liver kinase-1; protein-tyrosine kinase receptor Flk-1; tyrosine kinase growth factor receptor; |
| Gene ID | 3791 |
| mRNA Refseq | NM_002253 |
| Protein Refseq | NP_002244 |
| MIM | 191306 |
| UniProt ID | P35968 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KDR Products
Required fields are marked with *
My Review for All KDR Products
Required fields are marked with *



