Recombinant Human KDR protein(1201-1300 aa), C-His-tagged

• Cat.No.: KDR-2742H
• Product Overview: Recombinant Human KDR protein(P35968)(1201-1300 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1201-1300 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: CMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDSGMVLASEELKTLEDRTKLSPSFGGMVPSKSRESVASEGSN

Gene Information

• Gene Name: KDR kinase insert domain receptor (a type III receptor tyrosine kinase) [ Homo sapiens ]
• Official Symbol: KDR
• Synonyms: KDR; kinase insert domain receptor (a type III receptor tyrosine kinase); vascular endothelial growth factor receptor 2; CD309; FLK1; VEGFR; VEGFR2; soluble VEGFR2; fetal liver kinase 1; fetal liver kinase-1; protein-tyrosine kinase receptor Flk-1; tyrosine kinase growth factor receptor
• Gene ID: 3791
• mRNA Refseq: NM_002253
• Protein Refseq: NP_002244
• MIM: 191306
• UniProt ID: P35968