Recombinant Human KEAP1 protein, GST-tagged
Cat.No. : | KEAP1-653H |
Product Overview : | Recombinant Human KEAP1(1 a.a. - 624 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-624 a.a. |
Description : | This gene encodes a protein containing KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is followed by transportation of NF-E2-related factor 2 to the nucleus. This interaction results in the expression of the catalytic subunit of gamma-glutamylcysteine synthetase. Two alternatively spliced transcript variants encoding the same isoform have been found for this gene. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 94.38 kDa |
AA Sequence : | MQPDPRPSGAGACCRFLPLQSQCPEGAGDAVMYASTECKAEVTPSQHGNRTFSYTLEDHTKQAFGIMNELRLSQQ LCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGIHPKVMERLIEFAYTASISMGEK CVLHVMNGAVMYQIDSVVRACSDFLVQQLDPSNAIGIANFAEQIGCVELHQRAREYIYMHFGEVAKQEEFFNLSH CQLVTLISRDDLNVRCESEVFHACINWVKYDCEQRRFYVQALLRAVRCHSLTPNFLQMQLQKCEILQSDSRCKDY LVKIFEELTLHKPTQVMPCRAPKVGRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQVPRSGLAGCVVGGLLY AVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCIHHNSVERYEPERDEW HLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGY DGQDQLNSVERYDVETETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSG RSGVGVAVTMEPCRKQIDQQNCTC |
Usage : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | KEAP1 kelch-like ECH-associated protein 1 [ Homo sapiens ] |
Official Symbol | KEAP1 |
Synonyms | KEAP1; kelch-like ECH-associated protein 1; INrf2; KIAA0132; KLHL19; MGC1114; MGC4407; MGC9454; MGC10630; MGC20887; kelch-like protein 19; cytosolic inhibitor of Nrf2; |
Gene ID | 9817 |
mRNA Refseq | NM_203500 |
Protein Refseq | NP_987096 |
MIM | 606016 |
UniProt ID | Q14145 |
Chromosome Location | 19p13.2 |
Pathway | Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination and Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem; Immune System, organism-specific biosystem; Keap1-Nrf2 Pathway, organism-specific biosystem; |
Function | protein binding; |
◆ Recombinant Proteins | ||
KEAP1-653H | Recombinant Human KEAP1 protein, GST-tagged | +Inquiry |
KEAP1-829H | Recombinant Human KEAP1 protein, His-tagged | +Inquiry |
KEAP1-2185H | Recombinant Human KEAP1 Protein (1-624 aa), His-tagged | +Inquiry |
KEAP1-4789M | Recombinant Mouse KEAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
KEAP1-3481H | Recombinant Human KEAP1 Protein (Ala90-Ile250), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KEAP1-001HCL | Recombinant Human KEAP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KEAP1 Products
Required fields are marked with *
My Review for All KEAP1 Products
Required fields are marked with *