Recombinant Human KHDRBS1, GST-tagged

• Cat.No.: KHDRBS1-2876H
• Product Overview: Recombinant human KHDRBS1 (AAH10132.1, 1 a.a. - 381 a.a.) protein, fused with GST-tag at N-terminal, was expressed in vitro wheat germ expression system.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: KH domain-containing, RNA-binding, signal transduction-associated protein 1 is a protein that in humans is encoded by the KHDRBS1 gene.
• Purification: Glutathione Sepharose 4 Fast Flow
• Sequence: MQRRDDPAARMSRSSGRSGSMDPSGAHPSVRQTPSRQPPLPHRSRGGGGGSRGGARASPATQPPPLLPPSATGPDATVGGPAPTPLLPPSATASVKMEPENKYLPELMAEKDSLDPSFTHAMQLLTAEIEKIQKGDSKKDDEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLNGVPEPSRGRGVPVRGRGAAPPPPPVPRGRGVGPPRGALVRGTPVRGAITRGATVTRGVPPPPTVRGAPAPRARTAGIQRIPLPPPPAPETYEEYVRNLNNVPFPST
• Molecular Mass: 67.4 kDa
• Applications: ELISA; WB; Antibody Production; Protein Array
• Note: Best use within three months from the date of receipt of this protein.
• Storage Buffer: Liquid with 50 mM Tris-HCI, 10 mM reduced Glutathione, pH8.0 in the elution buffer.
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• OfficialSymbol: KHDRBS1

Gene Information

• Gene Name: KHDRBS1 KH domain containing, RNA binding, signal transduction associated 1 [ Homo sapiens ]
• Synonyms: KHDRBS1; KH domain containing, RNA binding, signal transduction associated 1; p62; p68; Sam68; FLJ34027; src-associated in mitosis 68 kDa protein; p21 Ras GTPase-activating protein-associated p62; GAP-associated tyrosine phosphoprotein p62 (Sam68); KH domain containing, RNA binding, signal transduction; associated 1; KH domain-containing, RNA-binding, signal transduction-associated protein 1; SAM68; GAP-associated tyrosine phosphoprotein p62
• Gene ID: 10657
• mRNA Refseq: NM_006559
• Protein Refseq: NP_006550
• MIM: 602489
• UniProt ID: Q07666
• Chromosome Location: 1p32
• Pathway: T Cell Receptor Signaling Pathway
• Function: DNA binding; RNA binding; SH3 domain binding; SH3/SH2 adaptor activity; protein binding