Recombinant Human KHDRBS1, GST-tagged

Cat.No. : KHDRBS1-2876H
Product Overview : Recombinant human KHDRBS1 (AAH10132.1, 1 a.a. - 381 a.a.) protein, fused with GST-tag at N-terminal, was expressed in vitro wheat germ expression system.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : KH domain-containing, RNA-binding, signal transduction-associated protein 1 is a protein that in humans is encoded by the KHDRBS1 gene.
Purification : Glutathione Sepharose 4 Fast Flow
Sequence : MQRRDDPAARMSRSSGRSGSMDPSGAHPSVRQTPSRQPPLPHRSRGGGGGSRGGARASPATQPPPLLPPSATGPDATVGGPAPTPLLPPSATASVKMEPENKYLPELMAEKDSLDPSFTHAMQLLTAEIEKIQKGDSKKDDEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLNGVPEPSRGRGVPVRGRGAAPPPPPVPRGRGVGPPRGALVRGTPVRGAITRGATVTRGVPPPPTVRGAPAPRARTAGIQRIPLPPPPAPETYEEYVRNLNNVPFPST
Molecular Mass : 67.4 kDa
Applications : ELISA; WB; Antibody Production; Protein Array
Note : Best use within three months from the date of receipt of this protein.
Storage Buffer : Liquid with 50 mM Tris-HCI, 10 mM reduced Glutathione, pH8.0 in the elution buffer.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
OfficialSymbol : KHDRBS1
Gene Name KHDRBS1 KH domain containing, RNA binding, signal transduction associated 1 [ Homo sapiens ]
Synonyms KHDRBS1; KH domain containing, RNA binding, signal transduction associated 1; p62; p68; Sam68; FLJ34027; src-associated in mitosis 68 kDa protein; p21 Ras GTPase-activating protein-associated p62; GAP-associated tyrosine phosphoprotein p62 (Sam68); KH domain containing, RNA binding, signal transduction; associated 1; KH domain-containing, RNA-binding, signal transduction-associated protein 1; SAM68; GAP-associated tyrosine phosphoprotein p62
Gene ID 10657
mRNA Refseq NM_006559
Protein Refseq NP_006550
MIM 602489
UniProt ID Q07666
Chromosome Location 1p32
Pathway T Cell Receptor Signaling Pathway
Function DNA binding; RNA binding; SH3 domain binding; SH3/SH2 adaptor activity; protein binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KHDRBS1 Products

Required fields are marked with *

My Review for All KHDRBS1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon