Recombinant Human KIAA0226 protein, His-tagged

• Cat.No.: KIAA0226-2428H
• Product Overview: Recombinant Human KIAA0226 protein(61-290 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 61-290 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: VAELWLQHSLQYHCLSAQLRPLLGDRQYIRKFYTDAAFLLSDAHVTAMLQCLEAVEQNNPRLLAQIDASMFARKHESPLLVTKSQSLTALPSSTYTPPNSYAQHSYFGSFSSLHQSVPNNGSERRSTSFPLSGPPRKPQESRGHVSPAEDQTIQAPPVSVSALARDSPLTPNEMSSSTLTSPIEASWVSSQNDSPGDASEGPEYLAIGNLDPRGRTASCQSHSSNAESSS
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: KIAA0226 KIAA0226 [ Homo sapiens ]
• Official Symbol: KIAA0226
• Synonyms: KIAA0226; run domain Beclin-1 interacting and cystein-rich containing protein; rubicon; RUN domain and cysteine rich domain containing; Beclin 1 interacting protein; rundataxin; baron; beclin-1 associated RUN domain containing protein; RUN domain protein as Beclin 1-interacting and cysteine-rich containing; RUN domain and cysteine-rich domain containing, Beclin 1-interacting protein; RUBICON
• Gene ID: 9711
• mRNA Refseq: NM_014687
• Protein Refseq: NP_055502
• MIM: 613516
• UniProt ID: Q92622