Recombinant Human KIAA0226 protein, His-tagged
Cat.No. : | KIAA0226-2428H |
Product Overview : | Recombinant Human KIAA0226 protein(61-290 aa), fused to His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 61-290 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | VAELWLQHSLQYHCLSAQLRPLLGDRQYIRKFYTDAAFLLSDAHVTAMLQCLEAVEQNNPRLLAQIDASMFARKHESPLLVTKSQSLTALPSSTYTPPNSYAQHSYFGSFSSLHQSVPNNGSERRSTSFPLSGPPRKPQESRGHVSPAEDQTIQAPPVSVSALARDSPLTPNEMSSSTLTSPIEASWVSSQNDSPGDASEGPEYLAIGNLDPRGRTASCQSHSSNAESSS |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | KIAA0226 KIAA0226 [ Homo sapiens ] |
Official Symbol | KIAA0226 |
Synonyms | KIAA0226; run domain Beclin-1 interacting and cystein-rich containing protein; rubicon; RUN domain and cysteine rich domain containing; Beclin 1 interacting protein; rundataxin; baron; beclin-1 associated RUN domain containing protein; RUN domain protein as Beclin 1-interacting and cysteine-rich containing; RUN domain and cysteine-rich domain containing, Beclin 1-interacting protein; RUBICON; |
Gene ID | 9711 |
mRNA Refseq | NM_014687 |
Protein Refseq | NP_055502 |
MIM | 613516 |
UniProt ID | Q92622 |
◆ Recombinant Proteins | ||
KIAA0226-406H | Recombinant Human KIAA0226 Protein, MYC/DDK-tagged | +Inquiry |
KIAA0226-2428H | Recombinant Human KIAA0226 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KIAA0226 Products
Required fields are marked with *
My Review for All KIAA0226 Products
Required fields are marked with *
0
Inquiry Basket