Recombinant Human KIAA0319L protein, His-tagged
| Cat.No. : | KIAA0319L-323H |
| Product Overview : | Recombinant Human KIAA0319L protein(Q8IZA0)(961-1030 aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 961-1030 aa |
| Form : | Phosphate buffered saline |
| Molecular Mass : | 10 kDa |
| AASequence : | KPKRKSKYKILDATDQESLELKPTSRAGIKQKGLLLSSSLMHSESELDSDDAIFTWPDREKGKLLHGQNG |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | KIAA0319L KIAA0319-like [ Homo sapiens ] |
| Official Symbol | KIAA0319L |
| Synonyms | KIAA0319L; KIAA0319-like; dyslexia-associated protein KIAA0319-like protein; KIAA1837; polycystic kidney disease 1-related; FLJ44532; |
| Gene ID | 79932 |
| mRNA Refseq | NM_024874 |
| Protein Refseq | NP_079150 |
| MIM | 613535 |
| UniProt ID | Q8IZA0 |
| ◆ Recombinant Proteins | ||
| KIAA0319L-322H | Recombinant Human KIAA0319L protein, His-tagged | +Inquiry |
| KIAA0319L-323H | Recombinant Human KIAA0319L protein, His-tagged | +Inquiry |
| KIAA0319L-320H | Recombinant Human KIAA0319L, His-tagged | +Inquiry |
| KIAA0319L-27H | Recombinant Human KIAA0319L protein, GST-tagged | +Inquiry |
| KIAA0319L-6785HF | Recombinant Full Length Human KIAA0319L Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KIAA0319L-900HCL | Recombinant Human KIAA0319L cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KIAA0319L Products
Required fields are marked with *
My Review for All KIAA0319L Products
Required fields are marked with *
