Recombinant Human KIAA0319L protein, His-tagged

Cat.No. : KIAA0319L-323H
Product Overview : Recombinant Human KIAA0319L protein(Q8IZA0)(961-1030 aa), fused with C-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 961-1030 aa
Form : Phosphate buffered saline
Molecular Mass : 10 kDa
AASequence : KPKRKSKYKILDATDQESLELKPTSRAGIKQKGLLLSSSLMHSESELDSDDAIFTWPDREKGKLLHGQNG
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name KIAA0319L KIAA0319-like [ Homo sapiens ]
Official Symbol KIAA0319L
Synonyms KIAA0319L; KIAA0319-like; dyslexia-associated protein KIAA0319-like protein; KIAA1837; polycystic kidney disease 1-related; FLJ44532;
Gene ID 79932
mRNA Refseq NM_024874
Protein Refseq NP_079150
MIM 613535
UniProt ID Q8IZA0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KIAA0319L Products

Required fields are marked with *

My Review for All KIAA0319L Products

Required fields are marked with *

0
cart-icon