Recombinant Human KIAA1377 Protein (559-670 aa), His-SUMO-tagged
Cat.No. : | KIAA1377-1127H |
Product Overview : | Recombinant Human KIAA1377 Protein (559-670 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 559-670 aa |
Description : | Participates in cytokinesis . Necessary for microtubules and mitotic spindle organization . Involved in primary cilium formation . |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 28.9 kDa |
AA Sequence : | HKKMKYNIHERNGVRFLKSILKKESKYEHGYLKALIINQSFKFGNQKAAAIRDSIELTKEKGAEIPKTIKKLRWFDETSNIENNAENSHSLKNKTGTTQQHSQQFHIQSGAG |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | KIAA1377 KIAA1377 [ Homo sapiens ] |
Official Symbol | KIAA1377 |
Gene ID | 57562 |
mRNA Refseq | NM_020802.2 |
Protein Refseq | NP_065853.2 |
MIM | 614634 |
UniProt ID | Q9P2H0 |
◆ Recombinant Proteins | ||
KIAA1377-1127H | Recombinant Human KIAA1377 Protein (559-670 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KIAA1377 Products
Required fields are marked with *
My Review for All KIAA1377 Products
Required fields are marked with *
0
Inquiry Basket