Recombinant Human KIR2DL3 Protein, C-His-tagged
Cat.No. : | KIR2DL3-082H |
Product Overview : | Recombinant Human KIR2DL3 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Killer cell immunoglobulin-like receptors (KIRs) are type 1 transmembrane glycoproteins expressed by natural killer cells and subsets of CD4, CD8, and γδ T cells. Analogous to the diversity of their human leucocyte antigen class I (HLA Class I) ligands, the KIR genes are polymorphic and the content of the KIR gene cluster varies among haplotypes, although several "framework" genes are found in all haplotypes. The KIR proteins are characterized by the number of extracellular immunoglobulin-superfamily domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack an ITIM and instead transduce activating signals. KIR proteins play an important role in the regulation of the immune response. Combinations of KIR and HLA class I variants influence susceptibility to autoimmunity and infectious disease, as well as outcomes of haematopoietic stem cell transplantation. |
Molecular Mass : | ~25 kDa |
AA Sequence : | HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | KIR2DL3 killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 3 [ Homo sapiens (human) ] |
Official Symbol | KIR2DL3 |
Synonyms | KIR2DL3; killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 3; killer cell immunoglobulin-like receptor 2DL3; CD158B2; cl 6; nkat2; nkat2a; nkat2b; p58; NKAT-2; NK-receptor; p58 NK receptor CL-6; MHC class I NK cell receptor; killer inhibitory receptor cl 2-3; CD158 antigen-like family member B2; natural killer associated transcript 2; natural killer-associated transcript 2; p58.2 MHC class-I specific NK receptor; p58.2 MHC class-I-specific NK receptor; p58 natural killer cell receptor clone CL-6; natural killer cell inhibitory receptor KIR2DL3; NKAT; GL183; NKAT2; CD158b; NKAT2A; NKAT2B; KIR-K7b; KIR-K7c; KIRCL23; KIR-023GB; MGC129943; |
Gene ID | 3804 |
mRNA Refseq | NM_015868 |
Protein Refseq | NP_056952 |
MIM | 604938 |
UniProt ID | P43628 |
◆ Recombinant Proteins | ||
KIR2DL3-082H | Recombinant Human KIR2DL3 Protein, C-His-tagged | +Inquiry |
KIR2DL3-4339H | Recombinant Human KIR2DL3 Protein (Met1-His245), C-Fc tagged | +Inquiry |
KIR2DL3-8189H | Recombinant Human KIR2DL3 protein, His & GST-tagged | +Inquiry |
KIR2DL3-341H | Recombinant Human KIR2DL3 Protein, Fc-tagged | +Inquiry |
KIR2DL3-6968H | Recombinant Human KIR2DL3 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KIR2DL3-1840HCL | Recombinant Human KIR2DL3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KIR2DL3 Products
Required fields are marked with *
My Review for All KIR2DL3 Products
Required fields are marked with *