Recombinant Human KIR2DL3 protein, His-tagged

Cat.No. : KIR2DL3-3240H
Product Overview : Recombinant Human KIR2DL3 protein(20-247 aa), fused with N-terminal His tag, was expressed in E.coli.
Availability November 21, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 20-247 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AASequence : WPHEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWLSPTEPSSETGNPRHLHVL
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name KIR2DL3 killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 3 [ Homo sapiens ]
Official Symbol KIR2DL3
Synonyms KIR2DL3; killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 3; killer cell immunoglobulin-like receptor 2DL3; CD158B2; cl 6; nkat2; nkat2a; nkat2b; p58; NKAT-2; NK-receptor; p58 NK receptor CL-6; MHC class I NK cell receptor; killer inhibitory receptor cl 2-3; CD158 antigen-like family member B2; natural killer associated transcript 2; natural killer-associated transcript 2; p58.2 MHC class-I specific NK receptor; p58.2 MHC class-I-specific NK receptor; p58 natural killer cell receptor clone CL-6; natural killer cell inhibitory receptor KIR2DL3; NKAT; GL183; NKAT2; CD158b; NKAT2A; NKAT2B; KIR-K7b; KIR-K7c; KIRCL23; KIR-023GB; MGC129943;
Gene ID 3804
mRNA Refseq NM_015868
Protein Refseq NP_056952
MIM 604938
UniProt ID P43628

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KIR2DL3 Products

Required fields are marked with *

My Review for All KIR2DL3 Products

Required fields are marked with *

0
cart-icon
0
compare icon