Recombinant Human KIR2DL3 protein, His-tagged

• Cat.No.: KIR2DL3-3240H
• Product Overview: Recombinant Human KIR2DL3 protein(20-247 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 20-247 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: WPHEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWLSPTEPSSETGNPRHLHVL
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: KIR2DL3 killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 3 [ Homo sapiens ]
• Official Symbol: KIR2DL3
• Synonyms: KIR2DL3; killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 3; killer cell immunoglobulin-like receptor 2DL3; CD158B2; cl 6; nkat2; nkat2a; nkat2b; p58; NKAT-2; NK-receptor; p58 NK receptor CL-6; MHC class I NK cell receptor; killer inhibitory receptor cl 2-3; CD158 antigen-like family member B2; natural killer associated transcript 2; natural killer-associated transcript 2; p58.2 MHC class-I specific NK receptor; p58.2 MHC class-I-specific NK receptor; p58 natural killer cell receptor clone CL-6; natural killer cell inhibitory receptor KIR2DL3; NKAT; GL183; NKAT2; CD158b; NKAT2A; NKAT2B; KIR-K7b; KIR-K7c; KIRCL23; KIR-023GB; MGC129943
• Gene ID: 3804
• mRNA Refseq: NM_015868
• Protein Refseq: NP_056952
• MIM: 604938
• UniProt ID: P43628