Recombinant Human KIR2DL3 protein, His-tagged
| Cat.No. : | KIR2DL3-3240H |
| Product Overview : | Recombinant Human KIR2DL3 protein(20-247 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | November 21, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 20-247 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | WPHEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWLSPTEPSSETGNPRHLHVL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | KIR2DL3 killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 3 [ Homo sapiens ] |
| Official Symbol | KIR2DL3 |
| Synonyms | KIR2DL3; killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 3; killer cell immunoglobulin-like receptor 2DL3; CD158B2; cl 6; nkat2; nkat2a; nkat2b; p58; NKAT-2; NK-receptor; p58 NK receptor CL-6; MHC class I NK cell receptor; killer inhibitory receptor cl 2-3; CD158 antigen-like family member B2; natural killer associated transcript 2; natural killer-associated transcript 2; p58.2 MHC class-I specific NK receptor; p58.2 MHC class-I-specific NK receptor; p58 natural killer cell receptor clone CL-6; natural killer cell inhibitory receptor KIR2DL3; NKAT; GL183; NKAT2; CD158b; NKAT2A; NKAT2B; KIR-K7b; KIR-K7c; KIRCL23; KIR-023GB; MGC129943; |
| Gene ID | 3804 |
| mRNA Refseq | NM_015868 |
| Protein Refseq | NP_056952 |
| MIM | 604938 |
| UniProt ID | P43628 |
| ◆ Recombinant Proteins | ||
| RFL10148HF | Recombinant Full Length Human Killer Cell Immunoglobulin-Like Receptor 2Dl3(Kir2Dl3) Protein, His-Tagged | +Inquiry |
| KIR2DL3-1315H | Recombinant Human KIR2DL3 Protein (His22-Pro341), N-GST tagged | +Inquiry |
| KIR2DL3-3240H | Recombinant Human KIR2DL3 protein, His-tagged | +Inquiry |
| KIR2DL3-0323H | Active Recombinant Human KIR2DL3 protein, Fc-tagged | +Inquiry |
| KIR2DL3-557H | Active Recombinant Human KIR2DL3, Fc-tagged, Biotinylated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KIR2DL3-1840HCL | Recombinant Human KIR2DL3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KIR2DL3 Products
Required fields are marked with *
My Review for All KIR2DL3 Products
Required fields are marked with *
