Recombinant Human KIR2DL5A protein(22-238aa), His&Myc-tagged
| Cat.No. : | KIR2DL5A-5930H |
| Product Overview : | Recombinant Human KIR2DL5A protein(Q8N109)(22-238aa), fused with N-terminal His&C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 22-238aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 30.7 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | HEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSLYKEDGVPVPELYNKIFWKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGLFGKPSLSAQPGPTVRTGENVTLSCSSRSSFDMYHLSREGRAHEPRLPAVPSVNGTFQADFPLGPATHGGTYTCFGSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTEPSSKTGIRRH |
| Gene Name | KIR2DL5A killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 5A [ Homo sapiens ] |
| Official Symbol | KIR2DL5A |
| Synonyms | KIR2DL5A; killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 5A; CD158F; KIR2DL5; KIR2DL5.1; |
| Gene ID | 554278 |
| MIM | 605305 |
| UniProt ID | Q8N109 |
| ◆ Recombinant Proteins | ||
| KIR2DL5A-5668H | Active Recombinant Human Killer Cell Immunoglobulin-Like Receptor, Two Domains, Long Cytoplasmic Tail, 5A, Fc-tagged | +Inquiry |
| KIR2DL5A-8190H | Recombinant Human KIR2DL5A protein, His & T7-tagged | +Inquiry |
| KIR2DL5A-3784H | Recombinant Human KIR2DL5A Protein (Met1-His238), C-His tagged | +Inquiry |
| KIR2DL5A-728H | Active Recombinant Human KIR2DL5A Protein, Fc Chimera | +Inquiry |
| KIR2DL5A-279H | Recombinant Human KIR2DL5A Protein, His22-His240, C-His-Avi tagged, Biotinylated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KIR2DL5A-4940HCL | Recombinant Human KIR2DL5A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KIR2DL5A Products
Required fields are marked with *
My Review for All KIR2DL5A Products
Required fields are marked with *
