Recombinant Human KIR2DS2 Protein, C-His-tagged
Cat.No. : | KIR2DS2-002H |
Product Overview : | Recombinant Human KIR2DS2 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | KIR2DS2, receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells. |
Molecular Mass : | ~25 kDa |
AA Sequence : | HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFEHFLLHREGKYKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | KIR2DS2 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 2 [ Homo sapiens (human) ] |
Official Symbol | KIR2DS2 |
Synonyms | KIR2DS2; killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 2; killer cell immunoglobulin-like receptor 2DS2; 183ActI; CD158J; cl 49; nkat5; NKAT-5; p58 KIR; 1060P11.9.2; NK receptor 183 ActI; p58 NK receptor CL-49; MHC class I NK cell receptor; killer-cell Ig-like receptor; CD158 antigen-like family member J; natural killer associated transcript 5; natural killer-associated transcript 5; natural killer cell inhibitory receptor; p58 killer cell inhibitory receptor KIR-K7a; p58 natural killer cell receptor clone CL-49; killer-cell immunoglobulin-like receptor two domains short tail 2 protein; NKAT5; cl-49; CD158b; MGC120018; MGC120020; MGC149477; MGC149478; |
Gene ID | 100132285 |
mRNA Refseq | NM_012312 |
Protein Refseq | NP_036444 |
MIM | 604953 |
UniProt ID | P43631 |
◆ Recombinant Proteins | ||
KIR2DS2-151H | Recombinant Human KIR2DS2 Protein, His-tagged | +Inquiry |
RFL5330HF | Recombinant Full Length Human Killer Cell Immunoglobulin-Like Receptor 2Ds2(Kir2Ds2) Protein, His-Tagged | +Inquiry |
KIR2DS2-0908H | Recombinant Human KIR2DS2 Protein (His22-Glu291), N-GST tagged | +Inquiry |
KIR2DS2-06H | Recombinant Human KIR2DS2 Protein, Fc-tagged | +Inquiry |
KIR2DS2-553H | Recombinant Human KIR2DS2 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KIR2DS2-364HCL | Recombinant Human KIR2DS2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KIR2DS2 Products
Required fields are marked with *
My Review for All KIR2DS2 Products
Required fields are marked with *