Recombinant Human KIR2DS2 Protein, C-His-tagged

Cat.No. : KIR2DS2-002H
Product Overview : Recombinant Human KIR2DS2 Protein with C-His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : KIR2DS2, receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.
Molecular Mass : ~25 kDa
AA Sequence : HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFEHFLLHREGKYKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH
Purity : Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Notes : For research use only, not for use in diagnostic procedure.
Storage : Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
Concentration : ≥0.5 mg/mL
Storage Buffer : PBS, 4M Urea, pH7.4
Gene Name KIR2DS2 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 2 [ Homo sapiens (human) ]
Official Symbol KIR2DS2
Synonyms KIR2DS2; killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 2; killer cell immunoglobulin-like receptor 2DS2; 183ActI; CD158J; cl 49; nkat5; NKAT-5; p58 KIR; 1060P11.9.2; NK receptor 183 ActI; p58 NK receptor CL-49; MHC class I NK cell receptor; killer-cell Ig-like receptor; CD158 antigen-like family member J; natural killer associated transcript 5; natural killer-associated transcript 5; natural killer cell inhibitory receptor; p58 killer cell inhibitory receptor KIR-K7a; p58 natural killer cell receptor clone CL-49; killer-cell immunoglobulin-like receptor two domains short tail 2 protein; NKAT5; cl-49; CD158b; MGC120018; MGC120020; MGC149477; MGC149478;
Gene ID 100132285
mRNA Refseq NM_012312
Protein Refseq NP_036444
MIM 604953
UniProt ID P43631

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KIR2DS2 Products

Required fields are marked with *

My Review for All KIR2DS2 Products

Required fields are marked with *

0
cart-icon
0
compare icon