Recombinant Human KIR2DS3 Protein (22-245 aa), His-MBP-tagged
| Cat.No. : | KIR2DS3-2817H |
| Product Overview : | Recombinant Human KIR2DS3 Protein (22-245 aa) is produced by Baculovirus expression system. This protein is fused with a MBP tag at the N-terminal and a 6xHis tag at the C-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Insect Cells |
| Tag : | His&Myc |
| Protein Length : | 22-245 aa |
| Description : | Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 68.7 kDa |
| AA Sequence : | HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH |
| Purity : | > 85% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | KIR2DS3 killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 3 [ Homo sapiens (human) ] |
| Official Symbol | KIR2DS3 |
| Synonyms | KIR2DS3; NKAT7; |
| Gene ID | 3808 |
| mRNA Refseq | NM_012313 |
| Protein Refseq | NP_036445 |
| UniProt ID | Q14952 |
| ◆ Recombinant Proteins | ||
| KIR2DS3-2461H | Recombinant Human KIR2DS3 Protein (22-245 aa), His-tagged | +Inquiry |
| KIR2DS3-2313H | Recombinant Human KIR2DS3 Protein (22-245 aa), His-SUMO-Myc-tagged | +Inquiry |
| KIR2DS3-2817H | Recombinant Human KIR2DS3 Protein (22-245 aa), His-MBP-tagged | +Inquiry |
| KIR2DS3-4371H | Recombinant Human KIR2DS3 protein, His&Myc-tagged | +Inquiry |
| KIR2DS3-4382H | Recombinant Human KIR2DS3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KIR2DS3-4939HCL | Recombinant Human KIR2DS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KIR2DS3 Products
Required fields are marked with *
My Review for All KIR2DS3 Products
Required fields are marked with *
