Recombinant Human KIR2DS3 Protein (22-245 aa), His-SUMO-Myc-tagged

Cat.No. : KIR2DS3-2313H
Product Overview : Recombinant Human KIR2DS3 Protein (22-245 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc&SUMO
Protein Length : 22-245 aa
Description : Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 44.7 kDa
AA Sequence : HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name KIR2DS3 killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 3 [ Homo sapiens (human) ]
Official Symbol KIR2DS3
Synonyms KIR2DS3; NKAT7;
Gene ID 3808
mRNA Refseq NM_012313
Protein Refseq NP_036445
UniProt ID Q14952

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KIR2DS3 Products

Required fields are marked with *

My Review for All KIR2DS3 Products

Required fields are marked with *

0
cart-icon
0
compare icon