Recombinant Human KIT (D816V) protein, GST-tagged
| Cat.No. : | KIT-30H |
| Product Overview : | Recombinant Human KIT (D816V) mutant fused with GST tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Form : | Phosphate-Buffered Saline (PBS), pH 7.4. No preservatives added |
| Molecular Mass : | 135 kDa |
| AA Sequence : | MRGARGAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTDPGFVKWTFEILDETN ENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKG CQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLRE GEEFTVTCTIKDVSSSVYSTWKRENSQTKL |
| Purity : | >90 % as determined by SDS-PAGE analysis |
| Applications : | SDS-PAGE; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Storage : | Store at - 80 °C. Avoid repeated freeze/thaw cycles |
| Gene Name | KIT v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog [ Homo sapiens ] |
| Official Symbol | KIT |
| Synonyms | KIT; v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog; PBT, piebald trait; mast/stem cell growth factor receptor Kit; C Kit; CD117; SCFR; p145 c-kit; proto-oncogene c-Kit; piebald trait protein; soluble KIT variant 1; tyrosine-protein kinase Kit; proto-oncogene tyrosine-protein kinase Kit; v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene-like protein; PBT; C-Kit; |
| Gene ID | 3815 |
| mRNA Refseq | NM_000222 |
| Protein Refseq | NP_000213 |
| MIM | 164920 |
| UniProt ID | P10721 |
| Chromosome Location | 4q11-q12 |
| Pathway | Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; C-MYB transcription factor network, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; |
| Function | ATP binding; cytokine binding; metal ion binding; nucleotide binding; protease binding; protein binding; protein homodimerization activity; protein tyrosine kinase activity; receptor activity; receptor signaling protein tyrosine kinase activity; stem cell |
| ◆ Recombinant Proteins | ||
| KIT-113H | Active Recombinant Human KIT(V559D V654A), GST-tagged | +Inquiry |
| KIT-443HF | Recombinant Human KIT Protein, hFc-tagged, FITC conjugated | +Inquiry |
| KIT-162H | Recombinant Human KIT protein, DDK/His-tagged | +Inquiry |
| KIT-1253H | Recombinant Human KIT protein, His-tagged | +Inquiry |
| KIT-27174TH | Recombinant Human KIT, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KIT-1324RCL | Recombinant Rat KIT cell lysate | +Inquiry |
| KIT-001HCL | Recombinant Human KIT cell lysate | +Inquiry |
| KIT-2114MCL | Recombinant Mouse KIT cell lysate | +Inquiry |
| KIT-463HCL | Recombinant Human KIT cell lysate | +Inquiry |
| KIT-1405RCL | Recombinant Rat KIT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KIT Products
Required fields are marked with *
My Review for All KIT Products
Required fields are marked with *
