Recombinant Human KLC1, His-tagged

Cat.No. : KLC1-27879TH
Product Overview : Recombinant fragment, corresponding to amino acids 301-578 of Human Kinesin 2, with an N terminal His tag; MWt 32kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 301-578 a.a.
Description : Conventional kinesin is a tetrameric molecule composed of two heavy chains and two light chains, and transports various cargos along microtubules toward their plus ends. The heavy chains provide the motor activity, while the light chains bind to various cargos. This gene encodes a member of the kinesin light chain family. It associates with kinesin heavy chain through an N-terminal domain, and six tetratricopeptide repeat (TPR) motifs are thought to be involved in binding of cargos such as vesicles, mitochondria, and the Golgi complex. Thus, kinesin light chains function as adapter molecules and not motors per se. Although previously named "kinesin 2", this gene is not a member of the kinesin-2 / kinesin heavy chain subfamily of kinesin motor proteins. Extensive alternative splicing produces isoforms with different C-termini that are proposed to bind to different cargos; however, the full-length nature and/or biological validity of most of these variants have not been determined.
Conjugation : HIS
Tissue specificity : Found in a variety of tissues. Mostly abundant in brain and spine.
Form : Lyophilised:Reconstitute with 54 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : NNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAK QLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDP NVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREF GSVDDENKPIWMHAEEREECKGKQKDGTSFGEYGGWYK ACKVDSPTVTTTLKNLGALYRRQGKFEAAETLEEAAMRSR KQGLDNVHKQRVAEVLNDPENMEKRRSRESLNVDVVKY ESGPDGGEEVSMSVEWNGDGTGSLKRSGSFSKLRASIR RSSEKLVR
Sequence Similarities : Belongs to the kinesin light chain family.Contains 6 TPR repeats.
Gene Name KLC1 kinesin light chain 1 [ Homo sapiens ]
Official Symbol KLC1
Synonyms KLC1; kinesin light chain 1; kinesin 2 , kinesin 2 60/70kDa , KNS2; hKLC1B; hKLC1G; hKLC1J; hKLC1N; hKLC1P; hKLC1R; hKLC1S; KLC; KNS2A;
Gene ID 3831
mRNA Refseq NM_001130107
Protein Refseq NP_001123579
MIM 600025
Uniprot ID Q07866
Chromosome Location 14q32.3
Pathway Arf6 trafficking events, organism-specific biosystem; Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem; Kinesins, organism-specific biosystem; Salmonella infection, organism-specific biosystem;
Function microtubule motor activity; motor activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KLC1 Products

Required fields are marked with *

My Review for All KLC1 Products

Required fields are marked with *

0
cart-icon