Recombinant Human KLF1 protein, His-B2M-tagged
Cat.No. : | KLF1-395H |
Product Overview : | Recombinant Human KLF1 protein(NP_006554.1)(1-362aa) fused with two N-terminal tag, His tag and B2M tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | B2M&His |
Protein Length : | 1-362aa |
Description : | This gene encodes a hematopoietic-specific transcription factor that induces high-level expression of adult beta-globin and other erythroid genes. The zinc-finger protein binds to the DNA sequence CCACACCCT found in the beta hemoglobin promoter. Heterozygous loss-of-function mutations in this gene result in the dominant In(Lu) blood phenotype. |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 52.2 kDa |
AA Sequence : | MATAETALPSISTLTALGPFPDTQDDFLKWWRSEEAQDMGPGPPDPTEPPLHVKSEDQPGEEEDDERGADATWDLDLLLTNFSGPEPGGAPQTCALAPSEASGAQYPPPPETLGAYAGGPGLVAGLLGSEDHSGWVRPALRARAPDAFVGPALAPAPAPEPKALALQPVYPGPGAGSSGGYFPRTGLSVPAASGAPYGLLSGYPAMYPAPQYQGHFQLFRGLQGPAPGPATSPSFLSCLGPGTVGTGLGGTAEDPGVIAETAPSKRGRRSWARKRQAAHTCAHPGCGKSYTKSSHLKAHLRTHTGEKPYACTWEGCGWRFARSDELTRHYRKHTGQRPFRCQLCPRAFSRSDHLALHMKRHL |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KLF1 Kruppel like factor 1 [ Homo sapiens (human) ] |
Official Symbol | KLF1 |
Synonyms | CDAN4; EKLF; EKLF PEN |
Gene ID | 10661 |
mRNA Refseq | NM_006563.5 |
Protein Refseq | NP_006554.1 |
MIM | 600599 |
UniProt ID | Q13351 |
◆ Recombinant Proteins | ||
KLF1-395H | Recombinant Human KLF1 protein, His-B2M-tagged | +Inquiry |
KLF1-2411R | Recombinant Rhesus monkey KLF1 Protein, His-tagged | +Inquiry |
KLF1-01H | Recombinant Human KLF1 Protein, His-tagged | +Inquiry |
KLF1-8577Z | Recombinant Zebrafish KLF1 | +Inquiry |
KLF1-2232R | Recombinant Rhesus Macaque KLF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KLF1 Products
Required fields are marked with *
My Review for All KLF1 Products
Required fields are marked with *
0
Inquiry Basket