Recombinant Human KLF1 Protein, His-tagged

Cat.No. : KLF1-01H
Product Overview : Recombinant Human KLF1 Protein with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : This gene encodes a hematopoietic-specific transcription factor that induces high-level expression of adult beta-globin and other erythroid genes. The zinc-finger protein binds to the DNA sequence CCACACCCT found in the beta hemoglobin promoter. Heterozygous loss-of-function mutations in this gene result in the dominant In(Lu) blood phenotype.
Molecular Mass : 39 kDa
AA Sequence : MHHHHHHATAETALPSISTLTALGPFPDTQDDFLKWWRSEEAQDMGPGPPDPTEPPLHVKSEDQPGEEEDDERGADATWDLDLLLTNFSGPEPGGAPQTCALAPSEASGAQYPPPPETLGAYAGGPGLVAGLLGSEDHSGWVRPALRARAPDAFVGPALAPAPAPEPKALALQPVYPGPGAGSSGGYFPRTGLSVPAASGAPYGLLSGYPAMYPAPQYQGHFQLFRGLQGPAPGPATSPSFLSCLGPGTVGTGLGGTAEDPGVIAETAPSKRGRRSWARKRQAAHTCAHPGCGKSYTKSSHLKAHLRTHTGEKPYACTWEGCGWRFARSDELTRHYRKHTGQRPFRCQLCPRAFSRSDHLALHMKRHL
Purity : > 90% by SDS-PAGE and HPLC
Applications : MHHHHHHATAETALPSISTLTALGPFPDTQDDFLKWWRSEEAQDMGPGPPDPTEPPLHVKSEDQPGEEEDDERGADATWDLDLLLTNFSGPEPGGAPQTCALAPSEASGAQYPPPPETLGAYAGGPGLVAGLLGSEDHSGWVRPALRARAPDAFVGPALAPAPAPEPKALALQPVYPGPGAGSSGGYFPRTGLSVPAASGAPYGLLSGYPAMYPAPQYQGHFQLFRGLQGPAPGPATSPSFLSCLGPGTVGTGLGGTAEDPGVIAETAPSKRGRRSWARKRQAAHTCAHPGCGKSYTKSSHLKAHLRTHTGEKPYACTWEGCGWRFARSDELTRHYRKHTGQRPFRCQLCPRAFSRSDHLALHMKRHL
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.22 mg/mL
Storage Buffer : 25mM Tris, 0.15M NaCl, 10% glycerol, 1mM DTT, pH 8.0
Gene Name KLF1 KLF transcription factor 1 [ Homo sapiens (human) ]
Official Symbol KLF1
Synonyms KLF1; KLF transcription factor 1; EKLF; EKLF/KLF1; Krueppel-like factor 1; Kruppel like factor 1; erythroid Kruppel-like factor; erythroid krueppel-like transcription factor; erythroid-specific transcription factor EKLF
Gene ID 10661
mRNA Refseq NM_006563
Protein Refseq NP_006554
MIM 600599
UniProt ID Q13351

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KLF1 Products

Required fields are marked with *

My Review for All KLF1 Products

Required fields are marked with *

0
cart-icon
0
compare icon