Recombinant Human KLF3 protein, T7/His-tagged
| Cat.No. : | KLF3-168H |
| Product Overview : | Recombinant human KLF3 cDNA (345aa) protein fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFLMFDPVPVKQEAMDPVSVSYPSNYMESMKPNKYGVIYSTPLPEKFF QTPEGLSHGIQMEPVDLTVNKRSSPPSAGNSPSSLKFPSSHRRASPGLSMPSSSPPIKKYSPPSPGVQPFGVPLS MPPVMAAALSRHGIRSPGILPVIQPVVVQPVPFMYTSHLQQPLMVSLSEEMENSSSSMQVPVIESYEKPISQKKI KIEPGIEPQRTDYYPEEMSPPLMNSVSPPQALLQENHPSVIVQPGKRPLPVESPDTQRKRRIHRCDYDGCNKVYT KSSHLKAHRRTHTGEKPYKCTWEGCTWKFARSDELTRHFRKHTGIKPFQCPDCDRSFSRSDHLALHRKRHMLV |
| Purity : | >90% by SDS-PAGE. |
| Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Gene Name | KLF3 Kruppel-like factor 3 (basic) [ Homo sapiens ] |
| Official Symbol | KLF3 |
| Synonyms | KLF3; BKLF; TEF-2; transcript ch138; basic Kruppel-like factor; basic kruppel like factor; basic krueppel-like factor; MGC48279; |
| Gene ID | 51274 |
| mRNA Refseq | NM_016531 |
| Protein Refseq | NP_057615 |
| MIM | 609392 |
| UniProt ID | P57682 |
| Chromosome Location | 4p16.1-p15.2 |
| Pathway | Transcriptional misregulation in cancer, organism-specific biosystem; Transcriptional misregulation in cancer, conserved biosystem; |
| Function | DNA binding; metal ion binding; sequence-specific DNA binding transcription factor activity; zinc ion binding; |
| ◆ Recombinant Proteins | ||
| KLF3-168H | Recombinant Human KLF3 protein, T7/His-tagged | +Inquiry |
| KLF3-2235R | Recombinant Rhesus Macaque KLF3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| KLF3-933H | Recombinant Human KLF3 | +Inquiry |
| KLF3-15893H | Recombinant Human KLF3, His-tagged | +Inquiry |
| KLF3-9364Z | Recombinant Zebrafish KLF3 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KLF3-366HCL | Recombinant Human KLF3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLF3 Products
Required fields are marked with *
My Review for All KLF3 Products
Required fields are marked with *



