Recombinant Human KLF6

Cat.No. : KLF6-29903TH
Product Overview : Recombinant fragment corresponding to amino acids 1-261 of Human KLF6 with a N terminal proprietary tag; predicted MWt 54.71 kDa inclusive of tag. AAH04301
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 261 amino acids
Description : This gene encodes a member of the Kruppel-like family of transcription factors. The zinc finger protein is a transcriptional activator, and functions as a tumor suppressor. Multiple transcript variants encoding different isoforms have been found for this gene, some of which are implicated in carcinogenesis.
Molecular Weight : 54.710kDa inclusive of tags
Tissue specificity : Highly expressed in placenta followed by spleen, thymus, prostate, testis, small intestine and colon. Weakly expressed in pancreas, lung, liver, heart and skeletal muscle. Also expressed in fetal brain, spleen and thymus.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELE RYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKEESELK ISSSPPEDTLISPSFCYNLETNSLNSDVSSESSDSSEELS PTAKFTSDPIGEVLVSSGKLGSSVTSAPPSSPELSREPSQ LWGCVPGELPSPGKVRSGTSGKPGDKGNGDASPDGRRRVH RCHFNGCRKVYTKSSHLKAHQRTHTGEKPYRCSWEGCEWR FARSDELTRHFRKHTGAKPF
Sequence Similarities : Belongs to the krueppel C2H2-type zinc-finger protein family.Contains 3 C2H2-type zinc fingers.
Gene Name KLF6 Kruppel-like factor 6 [ Homo sapiens ]
Official Symbol KLF6
Synonyms KLF6; Kruppel-like factor 6; BCD1, COPEB, core promoter element binding protein , ST12; Krueppel-like factor 6; CPBP; GBF; GC rich binding factor; PAC1; Zf9;
Gene ID 1316
mRNA Refseq NM_001160124
Protein Refseq NP_001153596
MIM 602053
Uniprot ID Q99612
Chromosome Location 10p15
Pathway Adipogenesis, organism-specific biosystem;
Function DNA binding; double-stranded DNA binding; metal ion binding; sequence-specific DNA binding transcription factor activity; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KLF6 Products

Required fields are marked with *

My Review for All KLF6 Products

Required fields are marked with *

0
cart-icon
0
compare icon