Recombinant Human KLHDC3 protein, His&Myc-tagged
Cat.No. : | KLHDC3-2336H |
Product Overview : | Recombinant Human KLHDC3 protein(Q9BQ90)(1-382aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His&Myc |
Protein Length : | 1-382aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 47 kDa |
AA Sequence : | MLRWTVHLEGGPRRVNHAAVAVGHRVYSFGGYCSGEDYETLRQIDVHIFNAVSLRWTKLPPVKSAIRGQAPVVPYMRYGHSTVLIDDTVLLWGGRNDTEGACNVLYAFDVNTHKWFTPRVSGTVPGARDGHSACVLGKIMYIFGGYEQQADCFSNDIHKLDTSTMTWTLICTKGSPARWRDFHSATMLGSHMYVFGGRADRFGPFHSNNEIYCNRIRVFDTRTEAWLDCPPTPVLPEGRRSHSAFGYNGELYIFGGYNARLNRHFHDLWKFNPVSFTWKKIEPKGKGPCPRRRQCCCIVGDKIVLFGGTSPSPEEGLGDEFDLIDHSDLHILDFSPSLKTLCKLAVIQYNLDQSCLPHDIRWELNAMTTNSNISRPIVSSHG |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KLHDC3 kelch domain containing 3 [ Homo sapiens ] |
Official Symbol | KLHDC3 |
Synonyms | KLHDC3; kelch domain containing 3; kelch domain-containing protein 3; dJ20C7.3; hPeas; PEAS; protein Peas; testis intracellular mediator protein; hPEAS; RP1-20C7.3; |
Gene ID | 116138 |
mRNA Refseq | NM_001242872 |
Protein Refseq | NP_001229801 |
MIM | 611248 |
UniProt ID | Q9BQ90 |
◆ Recombinant Proteins | ||
KLHDC3-2931R | Recombinant Rat KLHDC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
KLHDC3-405H | Recombinant Human KLHDC3 Protein, His&Myc-tagged | +Inquiry |
KLHDC3-3275R | Recombinant Rat KLHDC3 Protein | +Inquiry |
KLHDC3-2336H | Recombinant Human KLHDC3 protein, His&Myc-tagged | +Inquiry |
KLHDC3-12462Z | Recombinant Zebrafish KLHDC3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLHDC3-4921HCL | Recombinant Human KLHDC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLHDC3 Products
Required fields are marked with *
My Review for All KLHDC3 Products
Required fields are marked with *