Recombinant Human KLHL20 protein, His-tagged
Cat.No. : | KLHL20-418H |
Product Overview : | Recombinant Human KLHL20 protein(Q9Y2M5, 191-340 aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 191-340 aa |
Form : | 0.15 M Phosphate buffered saline |
AA Sequence : | KFTQHNFQEVMESEEFMLLPANQLIDIISSDELNVRSEEQVFNAVMAWVKYSIQERRPQLPQVLQHVRLPLLSPKFLVGTVGSDPLIKSDEECRDLVDEAKNYLLLPQERPLMQGPRTRPRKPIRCGEVLFAVGGWCSGDAISSVERYDP |
Storage : | Store it under sterile conditions at -20°C to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | KLHL20 kelch-like 20 (Drosophila) [ Homo sapiens ] |
Official Symbol | KLHL20 |
Synonyms | KLHL20; kelch-like 20 (Drosophila); kelch-like protein 20; KHLHX; KLEIP; kelch-like protein X; Kelch motif containing protein; kelch-like ECT2 interacting protein; kelch-like ECT2-interacting protein; KLHLX; RP3-383J4.3; |
Gene ID | 27252 |
mRNA Refseq | NM_014458 |
Protein Refseq | NP_055273 |
UniProt ID | Q9Y2M5 |
◆ Recombinant Proteins | ||
KLHL20-8711M | Recombinant Mouse KLHL20 Protein | +Inquiry |
KLHL20-4855M | Recombinant Mouse KLHL20 Protein, His (Fc)-Avi-tagged | +Inquiry |
KLHL20-12245Z | Recombinant Zebrafish KLHL20 | +Inquiry |
KLHL20-417H | Recombinant Human KLHL20, His-tagged | +Inquiry |
KLHL20-2983C | Recombinant Chicken KLHL20 | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLHL20-943HCL | Recombinant Human KLHL20 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLHL20 Products
Required fields are marked with *
My Review for All KLHL20 Products
Required fields are marked with *