Recombinant Human KLHL20 protein, His-tagged

Cat.No. : KLHL20-418H
Product Overview : Recombinant Human KLHL20 protein(Q9Y2M5, 191-340 aa), fused with C-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 191-340 aa
Form : 0.15 M Phosphate buffered saline
AA Sequence : KFTQHNFQEVMESEEFMLLPANQLIDIISSDELNVRSEEQVFNAVMAWVKYSIQERRPQLPQVLQHVRLPLLSPKFLVGTVGSDPLIKSDEECRDLVDEAKNYLLLPQERPLMQGPRTRPRKPIRCGEVLFAVGGWCSGDAISSVERYDP
Storage : Store it under sterile conditions at -20°C to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name KLHL20 kelch-like 20 (Drosophila) [ Homo sapiens ]
Official Symbol KLHL20
Synonyms KLHL20; kelch-like 20 (Drosophila); kelch-like protein 20; KHLHX; KLEIP; kelch-like protein X; Kelch motif containing protein; kelch-like ECT2 interacting protein; kelch-like ECT2-interacting protein; KLHLX; RP3-383J4.3;
Gene ID 27252
mRNA Refseq NM_014458
Protein Refseq NP_055273
UniProt ID Q9Y2M5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KLHL20 Products

Required fields are marked with *

My Review for All KLHL20 Products

Required fields are marked with *

0
cart-icon
0
compare icon