Recombinant Human KLHL20 protein, His-tagged

• Cat.No.: KLHL20-418H
• Product Overview: Recombinant Human KLHL20 protein(Q9Y2M5, 191-340 aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 191-340 aa
• Form: 0.15 M Phosphate buffered saline
• AA Sequence: KFTQHNFQEVMESEEFMLLPANQLIDIISSDELNVRSEEQVFNAVMAWVKYSIQERRPQLPQVLQHVRLPLLSPKFLVGTVGSDPLIKSDEECRDLVDEAKNYLLLPQERPLMQGPRTRPRKPIRCGEVLFAVGGWCSGDAISSVERYDP
• Storage: Store it under sterile conditions at -20°C to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: KLHL20 kelch-like 20 (Drosophila) [ Homo sapiens ]
• Official Symbol: KLHL20
• Synonyms: KLHL20; kelch-like 20 (Drosophila); kelch-like protein 20; KHLHX; KLEIP; kelch-like protein X; Kelch motif containing protein; kelch-like ECT2 interacting protein; kelch-like ECT2-interacting protein; KLHLX; RP3-383J4.3
• Gene ID: 27252
• mRNA Refseq: NM_014458
• Protein Refseq: NP_055273
• UniProt ID: Q9Y2M5