Recombinant Human KLHL3 protein, His-tagged
| Cat.No. : | KLHL3-1410H |
| Product Overview : | Recombinant Human KLHL3 protein(1-301 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-301 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | MEGESVKLSSQTLIQAGDDEKNQRTITVNPAHMGKAFKVMNELRSKQLLCDVMIVAEDVEIEAHRVVLAACSPYFCAMFTGDMSESKAKKIEIKDVDGQTLSKLIDYIYTAEIEVTEENVQVLLPAASLLQLMDVRQNCCDFLQSQLHPTNCLGIRAFADVHTCTDLLQQANAYAEQHFPEVMLGEEFLSLSLDQVCSLISSDKLTVSSEEKVFEAVISWINYEKETRLEHMAKLMEHVRLPLLPRDYLVQTVEEEALIKNNNTCKDFLIEAMKYHLLPLDQRLLIKNPRTKPRTPVSLPK |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | KLHL3 kelch-like 3 (Drosophila) [ Homo sapiens ] |
| Official Symbol | KLHL3 |
| Synonyms | KLHL3; kelch-like 3 (Drosophila); kelch (Drosophila) like 3; kelch-like protein 3; KIAA1129; PHA2D; FLJ40871; MGC44594; |
| Gene ID | 26249 |
| mRNA Refseq | NM_001257194 |
| Protein Refseq | NP_001244123 |
| MIM | 605775 |
| UniProt ID | Q9UH77 |
| ◆ Recombinant Proteins | ||
| KLHL3-1254H | Recombinant Human KLHL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| KLHL3-2428R | Recombinant Rhesus monkey KLHL3 Protein, His-tagged | +Inquiry |
| KLHL3-1239H | Recombinant Human KLHL3 Protein (E2-L587), Tag Free | +Inquiry |
| KLHL3-2011H | Recombinant Human KLHL3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| KLHL3-2249R | Recombinant Rhesus Macaque KLHL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KLHL3-4908HCL | Recombinant Human KLHL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLHL3 Products
Required fields are marked with *
My Review for All KLHL3 Products
Required fields are marked with *
