Recombinant Human KLK10, His-tagged

Cat.No. : KLK10-121H
Product Overview : Recombinant Human Kallikrein 10 is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Ala31-Asn276) of Human KLK10 fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 31-276 a.a.
Description : Kallikreins are a subgroup of Serine Proteases having diverse physiological functions. Growing evidence suggests that many Kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen Kallikrein subfamily members located in a cluster on chromosome 19. Its encoded protein is secreted and may play a role in suppression of tumorigenesis in breast and prostate cancers. Alternate splicing of this gene results in multiple transcript variants encoding the same protein.
Form : Supplied as a 0.2 μM filtered solution of 20mM Tris-HCl, 150mM NaCl, pH 8.0
AA Sequence : AEAALLPQNDTRLDPEAYGAPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWAR VGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVPGPRVRALQLPY RCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPC QSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSNVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Store at Please minimize freeze-thaw cycles.
Gene Name KLK10 kallikrein-related peptidase 10 [ Homo sapiens ]
Official Symbol KLK10
Synonyms KLK10; kallikrein-related peptidase 10; kallikrein 10 , PRSSL1; kallikrein-10; NES1; kallikrein 10; protease serine-like 1; protease, serine-like, 1; normal epithelial cell-specific 1; breast normal epithelial cell associated serine protease; PRSSL1;
Gene ID 5655
mRNA Refseq NM_001077500
Protein Refseq NP_001070968
MIM 602673
UniProt ID O43240
Chromosome Location 19q13
Function peptidase activity; serine-type endopeptidase activity; serine-type peptidase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KLK10 Products

Required fields are marked with *

My Review for All KLK10 Products

Required fields are marked with *

0
cart-icon
0
compare icon