Recombinant Human KLK10, His-tagged
Cat.No. : | KLK10-121H |
Product Overview : | Recombinant Human Kallikrein 10 is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Ala31-Asn276) of Human KLK10 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 31-276 a.a. |
Description : | Kallikreins are a subgroup of Serine Proteases having diverse physiological functions. Growing evidence suggests that many Kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen Kallikrein subfamily members located in a cluster on chromosome 19. Its encoded protein is secreted and may play a role in suppression of tumorigenesis in breast and prostate cancers. Alternate splicing of this gene results in multiple transcript variants encoding the same protein. |
Form : | Supplied as a 0.2 μM filtered solution of 20mM Tris-HCl, 150mM NaCl, pH 8.0 |
AA Sequence : | AEAALLPQNDTRLDPEAYGAPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWAR VGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVPGPRVRALQLPY RCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPC QSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSNVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Store at Please minimize freeze-thaw cycles. |
Gene Name | KLK10 kallikrein-related peptidase 10 [ Homo sapiens ] |
Official Symbol | KLK10 |
Synonyms | KLK10; kallikrein-related peptidase 10; kallikrein 10 , PRSSL1; kallikrein-10; NES1; kallikrein 10; protease serine-like 1; protease, serine-like, 1; normal epithelial cell-specific 1; breast normal epithelial cell associated serine protease; PRSSL1; |
Gene ID | 5655 |
mRNA Refseq | NM_001077500 |
Protein Refseq | NP_001070968 |
MIM | 602673 |
UniProt ID | O43240 |
Chromosome Location | 19q13 |
Function | peptidase activity; serine-type endopeptidase activity; serine-type peptidase activity; |
◆ Recombinant Proteins | ||
KLK10-121H | Recombinant Human KLK10, His-tagged | +Inquiry |
KLK10-171H | Recombinant Human KLK10, His-tagged | +Inquiry |
KLK10-2683H | Recombinant Human KLK10 Protein (Ala31-Asn276), C-His tagged | +Inquiry |
Klk10-2370R | Recombinant Rat Klk10 Protein, His-tagged | +Inquiry |
KLK10-431H | Recombinant Human KLK10, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLK10-4904HCL | Recombinant Human KLK10 293 Cell Lysate | +Inquiry |
KLK10-4905HCL | Recombinant Human KLK10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLK10 Products
Required fields are marked with *
My Review for All KLK10 Products
Required fields are marked with *