Recombinant Human KLK10 protein, His-tagged
Cat.No. : | KLK10-3138H |
Product Overview : | Recombinant Human KLK10 protein(O43240)(31-274aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 31-274aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 30.8 kDa |
AA Sequence : | AEAALLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | KLK10 kallikrein-related peptidase 10 [ Homo sapiens ] |
Official Symbol | KLK10 |
Synonyms | KLK10; kallikrein-related peptidase 10; kallikrein 10 , PRSSL1; kallikrein-10; NES1; kallikrein 10; protease serine-like 1; protease, serine-like, 1; normal epithelial cell-specific 1; breast normal epithelial cell associated serine protease; PRSSL1; |
Gene ID | 5655 |
mRNA Refseq | NM_001077500 |
Protein Refseq | NP_001070968 |
MIM | 602673 |
UniProt ID | O43240 |
◆ Recombinant Proteins | ||
Klk10-2370R | Recombinant Rat Klk10 Protein, His-tagged | +Inquiry |
KLK10-121H | Recombinant Human KLK10, His-tagged | +Inquiry |
KLK10-431H | Recombinant Human KLK10, His-tagged | +Inquiry |
KLK10-5023H | Recombinant Human KLK10 Protein (Leu35-Asn276), N-His tagged | +Inquiry |
KLK10-2683H | Recombinant Human KLK10 Protein (Ala31-Asn276), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLK10-4904HCL | Recombinant Human KLK10 293 Cell Lysate | +Inquiry |
KLK10-4905HCL | Recombinant Human KLK10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLK10 Products
Required fields are marked with *
My Review for All KLK10 Products
Required fields are marked with *