Recombinant Human KLK12 protein(18-248aa), His&Myc-tagged
Cat.No. : | KLK12-7648H |
Product Overview : | Recombinant Human KLK12 protein(Q9UKR0)(18-248aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 18-248aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 32.4 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | ATPKIFNGTECGRNSQPWQVGLFEGTSLRCGGVLIDHRWVLTAAHCSGSRYWVRLGEHSLSQLDWTEQIRHSGFSVTHPGYLGASTSHEHDLRLLRLRLPVRVTSSVQPLPLPNDCATAGTECHVSGWGITNHPRNPFPDLLQCLNLSIVSHATCHGVYPGRITSNMVCAGGVPGQDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQDGIPGVYTYICKYVDWIRMIMRNN |
Gene Name | KLK12 kallikrein-related peptidase 12 [ Homo sapiens ] |
Official Symbol | KLK12 |
Synonyms | KLK12; kallikrein-related peptidase 12; kallikrein 12; kallikrein-12; KLK L5; kallikrein-like protein 5; KLKL5; KLK-L5; MGC42603; DKFZp686H1078; |
Gene ID | 43849 |
mRNA Refseq | NM_019598 |
Protein Refseq | NP_062544 |
MIM | 605539 |
UniProt ID | Q9UKR0 |
◆ Recombinant Proteins | ||
KLK12-834H | Active Recombinant Human KLK12 Protein, His-tagged | +Inquiry |
KLK12-7998H | Recombinant Human KLK12 protein, His & T7-tagged | +Inquiry |
KLK12-7648H | Recombinant Human KLK12 protein(18-248aa), His&Myc-tagged | +Inquiry |
KLK12-1977H | Active Recombinant Human Kallikrein-Related Peptidase 12, His-tagged | +Inquiry |
KLK12-3229H | Recombinant Human KLK12 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLK12-4903HCL | Recombinant Human KLK12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLK12 Products
Required fields are marked with *
My Review for All KLK12 Products
Required fields are marked with *