Recombinant Human KLK12 protein(18-248aa), His&Myc-tagged
| Cat.No. : | KLK12-7648H |
| Product Overview : | Recombinant Human KLK12 protein(Q9UKR0)(18-248aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 18-248aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 32.4 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | ATPKIFNGTECGRNSQPWQVGLFEGTSLRCGGVLIDHRWVLTAAHCSGSRYWVRLGEHSLSQLDWTEQIRHSGFSVTHPGYLGASTSHEHDLRLLRLRLPVRVTSSVQPLPLPNDCATAGTECHVSGWGITNHPRNPFPDLLQCLNLSIVSHATCHGVYPGRITSNMVCAGGVPGQDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQDGIPGVYTYICKYVDWIRMIMRNN |
| Gene Name | KLK12 kallikrein-related peptidase 12 [ Homo sapiens ] |
| Official Symbol | KLK12 |
| Synonyms | KLK12; kallikrein-related peptidase 12; kallikrein 12; kallikrein-12; KLK L5; kallikrein-like protein 5; KLKL5; KLK-L5; MGC42603; DKFZp686H1078; |
| Gene ID | 43849 |
| mRNA Refseq | NM_019598 |
| Protein Refseq | NP_062544 |
| MIM | 605539 |
| UniProt ID | Q9UKR0 |
| ◆ Recombinant Proteins | ||
| KLK12-4602H | Recombinant Human KLK12 Protein (Ala18-Asn248), N-His tagged | +Inquiry |
| KLK12-1977H | Active Recombinant Human Kallikrein-Related Peptidase 12, His-tagged | +Inquiry |
| KLK12-834H | Active Recombinant Human KLK12 Protein, His-tagged | +Inquiry |
| KLK12-7648H | Recombinant Human KLK12 protein(18-248aa), His&Myc-tagged | +Inquiry |
| KLK12-7998H | Recombinant Human KLK12 protein, His & T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KLK12-4903HCL | Recombinant Human KLK12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLK12 Products
Required fields are marked with *
My Review for All KLK12 Products
Required fields are marked with *
