Recombinant Human KLK3 protein

Cat.No. : KLK3-89H
Product Overview : Recombinant Human KLK3 protein was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 237
Description : The human tissue kallikrein (KLK) gene family contains 15 members that play important roles in cancer. Kallikrein-3, called prostate specific antigen (PSA), is a glycoprotein enzyme encoded in humans by the KLK3 gene. PSA is secreted by the epithelial cells of the prostate gland, hydrolyzes semenogelin-1 thus leading to the liquefaction of the seminal coagulum. PSA is an established tumor marker that aids in the diagnosis, staging, and follow up of prostate cancer.
Form : Lyophilized from a 0.2 μm filtered concentrated solution in 20mM Tris-HCl, pH 8.0, 150mM NaCl, 3% trehalose.
Molecular Mass : Approximately 26.1 kDa, a single non-glycosylated polypeptide chain containing 237 amino acids.
AA Sequence : IVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
Endotoxin : Less than 0.1 EU/μg of rHuPSA/Kallikrein-3 as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analyses.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name KLK3
Official Symbol KLK3
Synonyms KLK3; kallikrein-related peptidase 3; APS, kallikrein 3, (prostate specific antigen); prostate-specific antigen; PSA; seminin; P-30 antigen; kallikrein-3; semenogelase; gamma-seminoprotein; prostate specific antigen; APS; hK3; KLK2A1;
Gene ID 354
mRNA Refseq NM_001030047
Protein Refseq NP_001025218
MIM 176820
UniProt ID P07288

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KLK3 Products

Required fields are marked with *

My Review for All KLK3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon