Recombinant Human KLRC1 Protein, C-His-tagged

• Cat.No.: KLRC1-088H
• Product Overview: Recombinant Human KLRC1 Protein with C-His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: The activity of natural killer (NK) cells is regulated by members of multiple receptor families that recognize class I MHC molecules, such as the killer cell inhibitory receptor/leukocyte immunoglobulin-like receptor (KIR/LIR) family and the C-type lectin superfamily. The KIR/LIR family includes p91A (also designated pp130 or PIR-B, for paired immunoglobulin-like receptor-B) and p91B (also designated PIR-A). p91A acts as an inhibitory receptor through interactions with SHP-1, whereas p91B acts as an activating receptor. CD94, NKG2 and Ly-49 are members of the C-type lectin superfamily of type II membrane glycoproteins. CD94 forms heterodimers with NKG2 isoforms on the surface of NK cells, whereas Ly-49 isoforms form homodimers. NKG2-D, expressed on NK cells, gdT cells and CD8+αβ T cells, is a receptor for the stress inducible protein MICA, an antigen frequently expressed in epithelial tumors.
• Molecular Mass: ~15 kDa
• AA Sequence: PSTLIQRHNNSSLNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRNSSHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKHKL
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Concentration: ≥0.5 mg/mL
• Storage Buffer: PBS, 4M Urea, pH7.4

Gene Information

• Gene Name: KLRC1 killer cell lectin-like receptor subfamily C, member 1 [ Homo sapiens (human) ]
• Official Symbol: KLRC1
• Synonyms: KLRC1; killer cell lectin-like receptor subfamily C, member 1; NKG2; NKG2-A/NKG2-B type II integral membrane protein; CD159a; NKG2 1/B activating NK receptor; NKG2 A; NKG2 B; NK cell receptor A; C-lectin type II protein; natural killer cell lectin; natural killer group protein 2; NKG2-1/B activating NK receptor; NKG2-A/B-activating NK receptor; CD159 antigen-like family member A; NKG2-A/B type II integral membrane protein; NKG2A; CD159A; MGC13374; MGC59791
• Gene ID: 3821
• mRNA Refseq: NM_002259
• Protein Refseq: NP_002250
• MIM: 161555
• UniProt ID: P26715