Recombinant Human KLRC1 Protein, C-His-tagged
| Cat.No. : | KLRC1-088H |
| Product Overview : | Recombinant Human KLRC1 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | The activity of natural killer (NK) cells is regulated by members of multiple receptor families that recognize class I MHC molecules, such as the killer cell inhibitory receptor/leukocyte immunoglobulin-like receptor (KIR/LIR) family and the C-type lectin superfamily. The KIR/LIR family includes p91A (also designated pp130 or PIR-B, for paired immunoglobulin-like receptor-B) and p91B (also designated PIR-A). p91A acts as an inhibitory receptor through interactions with SHP-1, whereas p91B acts as an activating receptor. CD94, NKG2 and Ly-49 are members of the C-type lectin superfamily of type II membrane glycoproteins. CD94 forms heterodimers with NKG2 isoforms on the surface of NK cells, whereas Ly-49 isoforms form homodimers. NKG2-D, expressed on NK cells, gdT cells and CD8+αβ T cells, is a receptor for the stress inducible protein MICA, an antigen frequently expressed in epithelial tumors. |
| Molecular Mass : | ~15 kDa |
| AA Sequence : | PSTLIQRHNNSSLNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRNSSHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKHKL |
| Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
| Notes : | For research use only, not for use in diagnostic procedure. |
| Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
| Concentration : | ≥0.5 mg/mL |
| Storage Buffer : | PBS, 4M Urea, pH7.4 |
| Gene Name | KLRC1 killer cell lectin-like receptor subfamily C, member 1 [ Homo sapiens (human) ] |
| Official Symbol | KLRC1 |
| Synonyms | KLRC1; killer cell lectin-like receptor subfamily C, member 1; NKG2; NKG2-A/NKG2-B type II integral membrane protein; CD159a; NKG2 1/B activating NK receptor; NKG2 A; NKG2 B; NK cell receptor A; C-lectin type II protein; natural killer cell lectin; natural killer group protein 2; NKG2-1/B activating NK receptor; NKG2-A/B-activating NK receptor; CD159 antigen-like family member A; NKG2-A/B type II integral membrane protein; NKG2A; CD159A; MGC13374; MGC59791; |
| Gene ID | 3821 |
| mRNA Refseq | NM_002259 |
| Protein Refseq | NP_002250 |
| MIM | 161555 |
| UniProt ID | P26715 |
| ◆ Recombinant Proteins | ||
| Klrc1-256M | Recombinant Mouse Klrc1, His tagged | +Inquiry |
| KLRC1-7372H | Recombinant Human KLRC1, His tagged | +Inquiry |
| KLRC1-437H | Recombinant Human KLRC1, GST-tagged | +Inquiry |
| KLRC1-298H | Recombinant Human KLRC1 protein, hFc-tagged | +Inquiry |
| KLRC1-192H | Recombinant Human KLRC1 and CD94 Protein, Arg100-Leu233 and Ser34-Ile179, N-His-Avi tagged, Biotinylated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KLRC1-924MCL | Recombinant Mouse KLRC1 cell lysate | +Inquiry |
| KLRC1-986CCL | Recombinant Cynomolgus KLRC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLRC1 Products
Required fields are marked with *
My Review for All KLRC1 Products
Required fields are marked with *



