Recombinant Human KLRC1 Protein, C-His-tagged
Cat.No. : | KLRC1-088H |
Product Overview : | Recombinant Human KLRC1 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | The activity of natural killer (NK) cells is regulated by members of multiple receptor families that recognize class I MHC molecules, such as the killer cell inhibitory receptor/leukocyte immunoglobulin-like receptor (KIR/LIR) family and the C-type lectin superfamily. The KIR/LIR family includes p91A (also designated pp130 or PIR-B, for paired immunoglobulin-like receptor-B) and p91B (also designated PIR-A). p91A acts as an inhibitory receptor through interactions with SHP-1, whereas p91B acts as an activating receptor. CD94, NKG2 and Ly-49 are members of the C-type lectin superfamily of type II membrane glycoproteins. CD94 forms heterodimers with NKG2 isoforms on the surface of NK cells, whereas Ly-49 isoforms form homodimers. NKG2-D, expressed on NK cells, gdT cells and CD8+αβ T cells, is a receptor for the stress inducible protein MICA, an antigen frequently expressed in epithelial tumors. |
Molecular Mass : | ~15 kDa |
AA Sequence : | PSTLIQRHNNSSLNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRNSSHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKHKL |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | KLRC1 killer cell lectin-like receptor subfamily C, member 1 [ Homo sapiens (human) ] |
Official Symbol | KLRC1 |
Synonyms | KLRC1; killer cell lectin-like receptor subfamily C, member 1; NKG2; NKG2-A/NKG2-B type II integral membrane protein; CD159a; NKG2 1/B activating NK receptor; NKG2 A; NKG2 B; NK cell receptor A; C-lectin type II protein; natural killer cell lectin; natural killer group protein 2; NKG2-1/B activating NK receptor; NKG2-A/B-activating NK receptor; CD159 antigen-like family member A; NKG2-A/B type II integral membrane protein; NKG2A; CD159A; MGC13374; MGC59791; |
Gene ID | 3821 |
mRNA Refseq | NM_002259 |
Protein Refseq | NP_002250 |
MIM | 161555 |
UniProt ID | P26715 |
◆ Recombinant Proteins | ||
KLRC1-390C | Recombinant Cynomolgus Monkey KLRC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
KLRC1-644C | Recombinant Cynomolgus KLRC1 Protein, His-tagged | +Inquiry |
KLRC1-298H | Recombinant Human KLRC1 protein, hFc-tagged | +Inquiry |
KLRC1-2256R | Recombinant Rhesus Macaque KLRC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
KLRC1-2217C | Recombinant Cynomolgus/Rhesus KLRC1 protein, hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLRC1-986CCL | Recombinant Cynomolgus KLRC1 cell lysate | +Inquiry |
KLRC1-924MCL | Recombinant Mouse KLRC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KLRC1 Products
Required fields are marked with *
My Review for All KLRC1 Products
Required fields are marked with *
0
Inquiry Basket