Recombinant Human KLRG1 protein, GST-tagged

Cat.No. : KLRG1-129H
Product Overview : Recombinant Human KLRG1(1 a.a. - 189 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-189 a.a.
Description : Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. The protein encoded by this gene belongs to the killer cell lectin-like receptor (KLR) family, which is a group of transmembrane proteins preferentially expressed in NK cells. Studies in mice suggested that the expression of this gene may be regulated by MHC class I molecules. Alternatively spliced transcript variants have been reported, but their full-length natures have not yet been determined.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 47.6 kDa
AA Sequence : MTDSVIYSMLELPTATQAQNDYGPQQKSSSSRPSCSCLVAIALGLLTAVLLSVLLYQWILCQGSNYSTCASCPSC PDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLN FSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKVRL
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name KLRG1 killer cell lectin-like receptor subfamily G, member 1 [ Homo sapiens ]
Official Symbol KLRG1
Synonyms KLRG1; killer cell lectin-like receptor subfamily G, member 1; killer cell lectin-like receptor subfamily G member 1; 2F1; C type lectin domain family 15; member A; CLEC15A; MAFA; MAFA L; MAFA-like receptor; ITIM-containing receptor MAFA-L; C-type lectin domain family 15 member A; C-type lectin domain family 15, member A; mast cell function-associated antigen (ITIM-containing); MAFA-L; MAFA-2F1; MAFA-LIKE; MGC13600;
Gene ID 10219
mRNA Refseq NM_005810
Protein Refseq NP_005801
MIM 604874
UniProt ID Q96E93
Chromosome Location 12p13.31
Pathway Adaptive Immune System, organism-specific biosystem; Immune System, organism-specific biosystem; Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell, organism-specific biosystem;
Function binding; receptor activity; sugar binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KLRG1 Products

Required fields are marked with *

My Review for All KLRG1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon