Recombinant Mouse Klrg1 protein(57-188aa), His&Myc-tagged
Cat.No. : | Klrg1-3322M |
Product Overview : | Recombinant Mouse Klrg1 protein(O88713)(57-188aa), fused with N-terminal His and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 57-188aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 22.4 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | QRILCCGSKDSTCSHCPSCPILWTRNGSHCYYFSMEKKDWNSSLKFCADKGSHLLTFPDNQGVKLFGEYLGQDFYWIGLRNIDGWRWEGGPALSLRILTNSLIQRCGAIHRNGLQASSCEVALQWICKKVLY |
Gene Name | Klrg1 killer cell lectin-like receptor subfamily G, member 1 [ Mus musculus ] |
Official Symbol | Klrg1 |
Synonyms | KLRG1; killer cell lectin-like receptor subfamily G, member 1; killer cell lectin-like receptor subfamily G member 1; mast cell function-associated antigen 2F1; MAFA; 2F1-Ag; MAFA-L; MGC123930; |
Gene ID | 50928 |
mRNA Refseq | NM_016970 |
Protein Refseq | NP_058666 |
◆ Recombinant Proteins | ||
KLRG1-723H | Recombinant Human KLRG1 | +Inquiry |
KLRG1-130H | Recombinant Human KLRG1 protein, GST-tagged | +Inquiry |
Klrg1-1054M | Active Recombinant Mouse Klrg1 Protein, Fc Chimera | +Inquiry |
KLRG1-7104H | Recombinant Human KLRG1, His-tagged | +Inquiry |
Klrg1-3322M | Recombinant Mouse Klrg1 protein(57-188aa), His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLRG1-950HCL | Recombinant Human KLRG1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Klrg1 Products
Required fields are marked with *
My Review for All Klrg1 Products
Required fields are marked with *