Recombinant Human KLRG1 protein, GST-tagged
Cat.No. : | KLRG1-130H |
Product Overview : | Recombinant Human KLRG1(57 a.a. - 119 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 57-119 a.a. |
Description : | Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. The protein encoded by this gene belongs to the killer cell lectin-like receptor (KLR) family, which is a group of transmembrane proteins preferentially expressed in NK cells. Studies in mice suggested that the ex |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 32.67 kDa |
AA Sequence : | QWILCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEM |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | KLRG1 killer cell lectin-like receptor subfamily G, member 1 [ Homo sapiens ] |
Official Symbol | KLRG1 |
Synonyms | KLRG1; killer cell lectin-like receptor subfamily G, member 1; killer cell lectin-like receptor subfamily G member 1; 2F1; C type lectin domain family 15; member A; CLEC15A; MAFA; MAFA L; MAFA-like receptor; ITIM-containing receptor MAFA-L; C-type lectin domain family 15 member A; C-type lectin domain family 15, member A; mast cell function-associated antigen (ITIM-containing); MAFA-L; MAFA-2F1; MAFA-LIKE; MGC13600; |
Gene ID | 10219 |
mRNA Refseq | NM_005810 |
Protein Refseq | NP_005801 |
MIM | 604874 |
UniProt ID | Q96E93 |
Chromosome Location | 12p13.31 |
Pathway | Adaptive Immune System, organism-specific biosystem; Immune System, organism-specific biosystem; Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell, organism-specific biosystem; |
Function | binding; receptor activity; sugar binding; |
◆ Recombinant Proteins | ||
KLRG1-130H | Recombinant Human KLRG1 protein, GST-tagged | +Inquiry |
KLRG1-0321H | Active Recombinant Human KLRG1 protein, His-tagged | +Inquiry |
RFL33120MF | Recombinant Full Length Mouse Killer Cell Lectin-Like Receptor Subfamily G Member 1(Klrg1) Protein, His-Tagged | +Inquiry |
KLRG1-3240H | Recombinant Human KLRG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
KLRG1-6854H | Recombinant Human KLRG1 protein, hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLRG1-950HCL | Recombinant Human KLRG1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLRG1 Products
Required fields are marked with *
My Review for All KLRG1 Products
Required fields are marked with *