"KLRG1" Related Products

Expand
Expand

Recombinant Human KLRG1 protein, GST-tagged

Cat.No.: KLRG1-130H
Product Overview: Recombinant Human KLRG1(57 a.a. - 119 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. The protein encoded by this gene belongs to the killer cell lectin-like receptor (KLR) family, which is a group of transmembrane proteins preferentially expressed in NK cells. Studies in mice suggested that the expression of this gene may be regulated by MHC class I molecules. Alternatively spliced transcript variants have been reported, but their full-length natures have not yet been determined.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 32.67 kDa
AA Sequence: QWILCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEM
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: KLRG1 killer cell lectin-like receptor subfamily G, member 1 [ Homo sapiens ]
Official Symbol: KLRG1
Synonyms: KLRG1; killer cell lectin-like receptor subfamily G, member 1; killer cell lectin-like receptor subfamily G member 1; 2F1; C type lectin domain family 15; member A; CLEC15A; MAFA; MAFA L; MAFA-like receptor; ITIM-containing receptor MAFA-L; C-type lectin domain family 15 member A; C-type lectin domain family 15, member A; mast cell function-associated antigen (ITIM-containing); MAFA-L; MAFA-2F1; MAFA-LIKE; MGC13600;
Gene ID: 10219
mRNA Refseq: NM_005810
Protein Refseq: NP_005801
MIM: 604874
UniProt ID: Q96E93
Chromosome Location: 12p13.31
Pathway: Adaptive Immune System, organism-specific biosystem; Immune System, organism-specific biosystem; Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell, organism-specific biosystem;
Function: binding; receptor activity; sugar binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.