Recombinant Human KLRK1 Protein, GST-tagged
| Cat.No. : | KLRK1-4905H |
| Product Overview : | Human KLRK1 full-length ORF ( NP_031386.1, 1 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. This gene encodes a member of the NKG2 family, and the encoded transmembrane protein is characterized by a type II membrane orientation (extracellular C terminus) and the presence of a C-type lectin domain. The NKG2 gene family is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed in NK cells. [provided by RefSeq |
| Molecular Mass : | 51.7 kDa |
| AA Sequence : | MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIAVAMGIRFIIMVAIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | KLRK1 killer cell lectin-like receptor subfamily K, member 1 [ Homo sapiens ] |
| Official Symbol | KLRK1 |
| Synonyms | KLRK1; killer cell lectin-like receptor subfamily K, member 1; D12S2489E, DNA segment on chromosome 12 (unique) 2489 expressed sequence; NKG2-D type II integral membrane protein; CD314; KLR; NKG2 D; NKG2D; NK cell receptor D; NKG2-D-activating NK receptor; NKG2-D; D12S2489E; FLJ17759; FLJ75772; |
| Gene ID | 22914 |
| mRNA Refseq | NM_007360 |
| Protein Refseq | NP_031386 |
| MIM | 611817 |
| UniProt ID | P26718 |
| ◆ Cell & Tissue Lysates | ||
| KLRK1-002HCL | Recombinant Human KLRK1 cell lysate | +Inquiry |
| KLRK1-001HCL | Recombinant Human KLRK1 cell lysate | +Inquiry |
| KLRK1-001CCL | Recombinant Cynomolgus KLRK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLRK1 Products
Required fields are marked with *
My Review for All KLRK1 Products
Required fields are marked with *
