Recombinant Human KLRK1 Protein, GST-tagged
Cat.No. : | KLRK1-4905H |
Product Overview : | Human KLRK1 full-length ORF ( NP_031386.1, 1 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. This gene encodes a member of the NKG2 family, and the encoded transmembrane protein is characterized by a type II membrane orientation (extracellular C terminus) and the presence of a C-type lectin domain. The NKG2 gene family is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed in NK cells. [provided by RefSeq |
Molecular Mass : | 51.7 kDa |
AA Sequence : | MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIAVAMGIRFIIMVAIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KLRK1 killer cell lectin-like receptor subfamily K, member 1 [ Homo sapiens ] |
Official Symbol | KLRK1 |
Synonyms | KLRK1; killer cell lectin-like receptor subfamily K, member 1; D12S2489E, DNA segment on chromosome 12 (unique) 2489 expressed sequence; NKG2-D type II integral membrane protein; CD314; KLR; NKG2 D; NKG2D; NK cell receptor D; NKG2-D-activating NK receptor; NKG2-D; D12S2489E; FLJ17759; FLJ75772; |
Gene ID | 22914 |
mRNA Refseq | NM_007360 |
Protein Refseq | NP_031386 |
MIM | 611817 |
UniProt ID | P26718 |
◆ Recombinant Proteins | ||
KLRK1-0583H | Active Recombinant Human KLRK1 protein, mFc-tagged | +Inquiry |
KLRK1-663H | Recombinant Human KLRK1 Protein (Ile73-Val216), N-mFc-tagged | +Inquiry |
KLRK1-1533C | Recombinant Cynomolgus KLRK1 protein, His-tagged | +Inquiry |
Klrk1-4543M | Recombinant Mouse Klrk1 protein, hFc-tagged | +Inquiry |
KLRK1-392C | Recombinant Cynomolgus Monkey KLRK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLRK1-001CCL | Recombinant Cynomolgus KLRK1 cell lysate | +Inquiry |
KLRK1-002HCL | Recombinant Human KLRK1 cell lysate | +Inquiry |
KLRK1-001HCL | Recombinant Human KLRK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KLRK1 Products
Required fields are marked with *
My Review for All KLRK1 Products
Required fields are marked with *
0
Inquiry Basket