Recombinant Human KMT2D Protein, GST-tagged
Cat.No. : | KMT2D-5389H |
Product Overview : | Human MLL2 partial ORF ( NP_003473.1, 1487 a.a. - 1586 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a histone methyltransferase that methylates the Lys-4 position of histone H3. The encoded protein is part of a large protein complex called ASCOM, which has been shown to be a transcriptional regulator of the beta-globin and estrogen receptor genes. Mutations in this gene have been shown to be a cause of Kabuki syndrome. [provided by RefSeq, Oct 2010] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | SKLEGMFPAYLQEAFFGKELLDLSRKALFAVGVGRPSFGLGTPKAKGDGGSERKELPTSQKGDDGPDIADEESRGLEGKADTPGPEDGGVKASPVPSDPE |
Applications : | Antibody Production Functional Study Compound Screening |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KMT2D lysine methyltransferase 2D [ Homo sapiens (human) ] |
Official Symbol | KMT2D |
Synonyms | KMT2D; lysine methyltransferase 2D; MLL2; myeloid/lymphoid or mixed-lineage leukemia 2; TNRC21, trinucleotide repeat containing 21; histone-lysine N-methyltransferase MLL2; ALR; CAGL114; KMT2D; MLL4; ALL1-related protein; Kabuki make-up syndrome; lysine N-methyltransferase 2B; lysine N-methyltransferase 2D; Kabuki mental retardation syndrome; trinucleotide repeat containing 21; KMS; AAD10; KMT2B; KABUK1; TNRC21; |
Gene ID | 8085 |
mRNA Refseq | NM_003482 |
Protein Refseq | NP_003473 |
MIM | 602113 |
UniProt ID | O14686 |
◆ Recombinant Proteins | ||
KMT2D-55H | Recombinant Human KMT2D, GST-tagged | +Inquiry |
KMT2D-129H | Recombinant Human KMT2D Complex, His-tagged | +Inquiry |
KMT2D-0540H | Recombinant Human KMT2D Protein (H5382-M5536), GST tagged | +Inquiry |
KMT2D-5744H | Recombinant Human KMT2D protein, GST-tagged | +Inquiry |
KMT2D-3011H | Recombinant Human KMT2D protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KMT2D Products
Required fields are marked with *
My Review for All KMT2D Products
Required fields are marked with *