Recombinant Human KMT2D Protein, GST-tagged
| Cat.No. : | KMT2D-5389H |
| Product Overview : | Human MLL2 partial ORF ( NP_003473.1, 1487 a.a. - 1586 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a histone methyltransferase that methylates the Lys-4 position of histone H3. The encoded protein is part of a large protein complex called ASCOM, which has been shown to be a transcriptional regulator of the beta-globin and estrogen receptor genes. Mutations in this gene have been shown to be a cause of Kabuki syndrome. [provided by RefSeq, Oct 2010] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | SKLEGMFPAYLQEAFFGKELLDLSRKALFAVGVGRPSFGLGTPKAKGDGGSERKELPTSQKGDDGPDIADEESRGLEGKADTPGPEDGGVKASPVPSDPE |
| Applications : | Antibody Production Functional Study Compound Screening |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | KMT2D lysine methyltransferase 2D [ Homo sapiens (human) ] |
| Official Symbol | KMT2D |
| Synonyms | KMT2D; lysine methyltransferase 2D; MLL2; myeloid/lymphoid or mixed-lineage leukemia 2; TNRC21, trinucleotide repeat containing 21; histone-lysine N-methyltransferase MLL2; ALR; CAGL114; KMT2D; MLL4; ALL1-related protein; Kabuki make-up syndrome; lysine N-methyltransferase 2B; lysine N-methyltransferase 2D; Kabuki mental retardation syndrome; trinucleotide repeat containing 21; KMS; AAD10; KMT2B; KABUK1; TNRC21; |
| Gene ID | 8085 |
| mRNA Refseq | NM_003482 |
| Protein Refseq | NP_003473 |
| MIM | 602113 |
| UniProt ID | O14686 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KMT2D Products
Required fields are marked with *
My Review for All KMT2D Products
Required fields are marked with *
